Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3375
Gene name Gene Name - the full gene name approved by the HGNC.
Islet amyloid polypeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IAPP
Synonyms (NCBI Gene) Gene synonyms aliases
DAP, IAP
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018914 hsa-miR-335-5p Microarray 18185580
MIRT030101 hsa-miR-26b-5p Microarray 19088304
MIRT440479 hsa-miR-376a-3p HITS-CLIP 24374217
MIRT440477 hsa-miR-432-5p HITS-CLIP 24374217
MIRT440476 hsa-miR-1185-2-3p HITS-CLIP 24374217
Transcription factors
Transcription factor Regulation Reference
GATA4 Activation 17290010
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 22500019
GO:0005102 Function Signaling receptor binding IPI 22500019
GO:0005102 Function Signaling receptor binding TAS 2608057, 10342886
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147940 5329 ENSG00000121351
Protein
UniProt ID P10997
Protein name Islet amyloid polypeptide (IAPP) (Amylin) (Diabetes-associated peptide) (DAP) (Insulinoma amyloid peptide)
Protein function Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affe
PDB 1KUW , 2G48 , 2KB8 , 2L86 , 3DG1 , 3FPO , 3FR1 , 3FTH , 3FTK , 3FTL , 3FTR , 3G7V , 3G7W , 3HGZ , 5K5G , 5KNZ , 5KO0 , 5MGQ , 6UCJ , 6UCK , 6VW2 , 6Y1A , 6ZRF , 6ZRQ , 6ZRR , 7BG0 , 7M61 , 7M62 , 7M64 , 7M65 , 7YKW , 7YL0 , 7YL3 , 7YL7 , 8AWT , 8AZ0 , 8AZ1 , 8AZ2 , 8AZ3 , 8AZ4 , 8AZ5 , 8AZ6 , 8AZ7 , 8F0J , 8F0K , 8F2A , 8F2B , 8R4I , 8YG2 , 9GZ6 , 9GZP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00214 Calc_CGRP_IAPP 25 75 Calcitonin / CGRP / IAPP family Family
Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNA
VEVLKREPLNYLPL
Sequence length 89
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling
Maturity onset diabetes of the young
  G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Amyloid fiber formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Rocuronium dose requirement in breast cancer surgery N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 11445568, 11790844, 15292167, 15878744, 16467158, 18825272, 22206987, 22734583, 23133593, 23256729, 24218609, 24654599, 24703313, 25531836, 25903685
View all (12 more)
AA amyloidosis Stimulate 26453219, 9560308
Acute Disease Associate 32385803
Adenoma Islet Cell Associate 15878744, 18694973, 24703313, 2639135, 31705766, 31768548, 34044067, 38367541
Alzheimer Disease Associate 14752113, 22500019, 24898659, 28684415, 31947546, 36835187
Amyloidosis Associate 15878744, 17563070, 25531836
Bone Diseases Associate 26895962, 26911465
Carcinoid Tumor Associate 8317551
Cognition Disorders Inhibit 24898659
Cognition Disorders Associate 36835187