Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3375
Gene name Gene Name - the full gene name approved by the HGNC.	Islet amyloid polypeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IAPP
Synonyms (NCBI Gene) Gene synonyms aliases	DAP, IAP
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018914	hsa-miR-335-5p	Microarray	18185580
MIRT030101	hsa-miR-26b-5p	Microarray	19088304
MIRT440479	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440477	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440476	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440475	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT440479	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440477	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440476	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440475	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT1057988	hsa-miR-106a	CLIP-seq
MIRT1057989	hsa-miR-106b	CLIP-seq
MIRT1057990	hsa-miR-1200	CLIP-seq
MIRT1057991	hsa-miR-1234	CLIP-seq
MIRT1057992	hsa-miR-124	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057995	hsa-miR-150	CLIP-seq
MIRT1057996	hsa-miR-17	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT1057999	hsa-miR-20a	CLIP-seq
MIRT1058000	hsa-miR-20b	CLIP-seq
MIRT1058001	hsa-miR-302a	CLIP-seq
MIRT1058002	hsa-miR-302b	CLIP-seq
MIRT1058003	hsa-miR-302c	CLIP-seq
MIRT1058004	hsa-miR-302d	CLIP-seq
MIRT1058005	hsa-miR-302e	CLIP-seq
MIRT1058006	hsa-miR-31	CLIP-seq
MIRT1058007	hsa-miR-3149	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058011	hsa-miR-3714	CLIP-seq
MIRT1058012	hsa-miR-372	CLIP-seq
MIRT1058013	hsa-miR-373	CLIP-seq
MIRT1058014	hsa-miR-3910	CLIP-seq
MIRT1058015	hsa-miR-411	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT1058017	hsa-miR-4324	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT1058020	hsa-miR-4707-5p	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT1058023	hsa-miR-4731-5p	CLIP-seq
MIRT1058024	hsa-miR-4735-5p	CLIP-seq
MIRT1058025	hsa-miR-4742-5p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058027	hsa-miR-4775	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT1058030	hsa-miR-506	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058033	hsa-miR-512-3p	CLIP-seq
MIRT1058034	hsa-miR-519d	CLIP-seq
MIRT1058035	hsa-miR-520a-3p	CLIP-seq
MIRT1058036	hsa-miR-520b	CLIP-seq
MIRT1058037	hsa-miR-520c-3p	CLIP-seq
MIRT1058038	hsa-miR-520d-3p	CLIP-seq
MIRT1058039	hsa-miR-520e	CLIP-seq
MIRT1058040	hsa-miR-520g	CLIP-seq
MIRT1058041	hsa-miR-520h	CLIP-seq
MIRT1058042	hsa-miR-544b	CLIP-seq
MIRT1058043	hsa-miR-590-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq
MIRT1058045	hsa-miR-93	CLIP-seq
MIRT1057988	hsa-miR-106a	CLIP-seq
MIRT1057989	hsa-miR-106b	CLIP-seq
MIRT1057991	hsa-miR-1234	CLIP-seq
MIRT1057995	hsa-miR-150	CLIP-seq
MIRT1057996	hsa-miR-17	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057999	hsa-miR-20a	CLIP-seq
MIRT1058000	hsa-miR-20b	CLIP-seq
MIRT1058001	hsa-miR-302a	CLIP-seq
MIRT1058002	hsa-miR-302b	CLIP-seq
MIRT1058003	hsa-miR-302c	CLIP-seq
MIRT1058004	hsa-miR-302d	CLIP-seq
MIRT1058005	hsa-miR-302e	CLIP-seq
MIRT1058007	hsa-miR-3149	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058012	hsa-miR-372	CLIP-seq
MIRT1058013	hsa-miR-373	CLIP-seq
MIRT1058015	hsa-miR-411	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058020	hsa-miR-4707-5p	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058023	hsa-miR-4731-5p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT2013336	hsa-miR-495	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058033	hsa-miR-512-3p	CLIP-seq
MIRT1058034	hsa-miR-519d	CLIP-seq
MIRT1058035	hsa-miR-520a-3p	CLIP-seq
MIRT1058036	hsa-miR-520b	CLIP-seq
MIRT1058037	hsa-miR-520c-3p	CLIP-seq
MIRT1058038	hsa-miR-520d-3p	CLIP-seq
MIRT1058039	hsa-miR-520e	CLIP-seq
MIRT1058040	hsa-miR-520g	CLIP-seq
MIRT1058041	hsa-miR-520h	CLIP-seq
MIRT1058045	hsa-miR-93	CLIP-seq
MIRT1057990	hsa-miR-1200	CLIP-seq
MIRT2245556	hsa-miR-1283	CLIP-seq
MIRT1057997	hsa-miR-197	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2245557	hsa-miR-3115	CLIP-seq
MIRT1058008	hsa-miR-3155	CLIP-seq
MIRT1058009	hsa-miR-3155b	CLIP-seq
MIRT1058010	hsa-miR-3663-5p	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT1058017	hsa-miR-4324	CLIP-seq
MIRT1058018	hsa-miR-4438	CLIP-seq
MIRT1058021	hsa-miR-4716-5p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT1058026	hsa-miR-4763-5p	CLIP-seq
MIRT1058028	hsa-miR-4781-3p	CLIP-seq
MIRT2245558	hsa-miR-4795-3p	CLIP-seq
MIRT1058029	hsa-miR-484	CLIP-seq
MIRT1058031	hsa-miR-5095	CLIP-seq
MIRT1058032	hsa-miR-5096	CLIP-seq
MIRT1058042	hsa-miR-544b	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548808	hsa-miR-122	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT2548809	hsa-miR-1307	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2548810	hsa-miR-3135b	CLIP-seq
MIRT2548811	hsa-miR-3652	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT2548812	hsa-miR-4284	CLIP-seq
MIRT2548813	hsa-miR-4430	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548814	hsa-miR-4638-5p	CLIP-seq
MIRT2548815	hsa-miR-4715-3p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT2548816	hsa-miR-4772-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq
MIRT2548808	hsa-miR-122	CLIP-seq
MIRT1057993	hsa-miR-1281	CLIP-seq
MIRT2548809	hsa-miR-1307	CLIP-seq
MIRT1057994	hsa-miR-1343	CLIP-seq
MIRT1057998	hsa-miR-1976	CLIP-seq
MIRT2548810	hsa-miR-3135b	CLIP-seq
MIRT2548811	hsa-miR-3652	CLIP-seq
MIRT1058016	hsa-miR-4279	CLIP-seq
MIRT2548812	hsa-miR-4284	CLIP-seq
MIRT2548813	hsa-miR-4430	CLIP-seq
MIRT1058019	hsa-miR-4503	CLIP-seq
MIRT2548814	hsa-miR-4638-5p	CLIP-seq
MIRT2548815	hsa-miR-4715-3p	CLIP-seq
MIRT1058022	hsa-miR-4722-3p	CLIP-seq
MIRT2548816	hsa-miR-4772-3p	CLIP-seq
MIRT1058044	hsa-miR-629	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
GATA4	Activation	17290010

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	22500019
GO:0005102	Function	Signaling receptor binding	IPI	22500019
GO:0005102	Function	Signaling receptor binding	TAS	2608057, 10342886
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005515	Function	Protein binding	IPI	17051221, 22500019, 26840340
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17374526
GO:0005615	Component	Extracellular space	IEA
GO:0006915	Process	Apoptotic process	TAS	8152488
GO:0007165	Process	Signal transduction	TAS	10342886
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 35324283
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007267	Process	Cell-cell signaling	TAS	2608057
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22944668
GO:0008289	Function	Lipid binding	EXP	32077246
GO:0010628	Process	Positive regulation of gene expression	IGI	22500019
GO:0016234	Component	Inclusion body	IDA	22944668
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	TAS	22500019
GO:0031648	Process	Protein destabilization	IDA	22944668
GO:0042755	Process	Eating behavior	IEA
GO:0042802	Function	Identical protein binding	IDA	22944668
GO:0042802	Function	Identical protein binding	IPI	17640888, 18408164, 21130765, 24042052, 24561193, 26840340, 32541895
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS	22500019
GO:0043410	Process	Positive regulation of MAPK cascade	NAS	22500019
GO:0045453	Process	Bone resorption	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0048018	Function	Receptor ligand activity	IDA	22500019
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IGI	22500019
GO:0051260	Process	Protein homooligomerization	IDA	22944668
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	22500019
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	22500019
GO:0097646	Process	Calcitonin family receptor signaling pathway	IEA
GO:0097647	Process	Amylin receptor signaling pathway	IDA	35324283
GO:0097647	Process	Amylin receptor signaling pathway	IDA	35324283
GO:0097647	Process	Amylin receptor signaling pathway	IEA
GO:0097647	Process	Amylin receptor signaling pathway	IGI	22500019
GO:0097647	Process	Amylin receptor signaling pathway	ISS
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IGI	22500019
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:0150061	Process	Amylin receptor 3 signaling pathway	IDA	35324283
GO:1905907	Process	Negative regulation of amyloid fibril formation	TAS	22500019
GO:1990000	Process	Amyloid fibril formation	IDA	22944668

MIM	HGNC	e!Ensembl
147940	5329	ENSG00000121351

Protein

UniProt ID

P10997

Protein name

Islet amyloid polypeptide (IAPP) (Amylin) (Diabetes-associated peptide) (DAP) (Insulinoma amyloid peptide)

Protein function

Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affe

PDB

1KUW , 2G48 , 2KB8 , 2L86 , 3DG1 , 3FPO , 3FR1 , 3FTH , 3FTK , 3FTL , 3FTR , 3G7V , 3G7W , 3HGZ , 5K5G , 5KNZ , 5KO0 , 5MGQ , 6UCJ , 6UCK , 6VW2 , 6Y1A , 6ZRF , 6ZRQ , 6ZRR , 7BG0 , 7M61 , 7M62 , 7M64 , 7M65 , 7YKW , 7YL0 , 7YL3 , 7YL7 , 8AWT , 8AZ0 , 8AZ1 , 8AZ2 , 8AZ3 , 8AZ4 , 8AZ5 , 8AZ6 , 8AZ7 , 8F0J , 8F0K , 8F2A , 8F2B , 8R4I , 8YG2 , 9GZ6 , 9GZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00214	Calc_CGRP_IAPP	25 → 75	Calcitonin / CGRP / IAPP family	Family

Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNAVEVLKREPLNYLPL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling Maturity onset diabetes of the young		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production Amyloid fiber formation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Rocuronium dose requirement in breast cancer surgery	N/A	N/A	GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	11445568, 11790844, 15292167, 15878744, 16467158, 18825272, 22206987, 22734583, 23133593, 23256729, 24218609, 24654599, 24703313, 25531836, 25903685 View all (12 more)
AA amyloidosis	Stimulate	26453219, 9560308
Acute Disease	Associate	32385803
Adenoma Islet Cell	Associate	15878744, 18694973, 24703313, 2639135, 31705766, 31768548, 34044067, 38367541
Alzheimer Disease	Associate	14752113, 22500019, 24898659, 28684415, 31947546, 36835187
Amyloidosis	Associate	15878744, 17563070, 25531836
Bone Diseases	Associate	26895962, 26911465
Carcinoid Tumor	Associate	8317551
Cognition Disorders	Inhibit	24898659
Cognition Disorders	Associate	36835187
COVID 19	Associate	37246981
Dementia	Associate	27354094
Dementia Vascular	Associate	31947546
Diabetes Mellitus	Associate	11395927, 15878744, 16467158, 20421596, 25903685, 26895962, 26911465, 28614667, 31922743, 32929282, 36549505
Diabetes Mellitus Type 1	Associate	33832546
Diabetes Mellitus Type 2	Associate	10931181, 11445568, 11790844, 15878744, 16467158, 17563070, 18556473, 18694973, 19015532, 19475663, 20421596, 20698575, 21195086, 22174920, 22206987 View all (37 more)
Diffuse Neurofibrillary Tangles with Calcification	Associate	36835187
Drug Related Side Effects and Adverse Reactions	Inhibit	16467158
Drug Related Side Effects and Adverse Reactions	Associate	18556473, 21195086, 29526462, 31922743
Drug Related Side Effects and Adverse Reactions	Stimulate	30015901, 31947546
Gastrinoma	Associate	8317551
Gastro enteropancreatic neuroendocrine tumor	Associate	8317551
Gingival Diseases	Associate	33934404
Heart Diseases	Associate	29526462
Herpes Zoster	Associate	32385803
Hippocampal Sclerosis	Associate	27815632, 30682540
Inflammation	Associate	37544243
Insulin Resistance	Associate	33832546, 39174611, 9560308
Insulinoma	Associate	16869889, 20421596, 2365085, 2639135, 2651160, 3053705, 3181427, 8317551
Intervertebral Disc Degeneration	Inhibit	28433710
Islet cell tumor syndrome	Associate	34614009
Melanoma	Associate	28337955
Metabolic Syndrome	Associate	20807286
Microphthalmia Syndromic 10	Associate	27815632
Myotonic Dystrophy	Associate	20421596
Neointima	Associate	11445568, 18694973, 21195086, 22206987, 23256729, 24703313, 25531836, 31705766, 31768548, 38367541
Neoplasms	Associate	33500359, 8317551
Neurodegenerative Diseases	Associate	33832546
Neurologic Manifestations	Associate	34759019
Obesity	Associate	26911465
Osteoporosis	Associate	37361541
Pancreatic Neoplasms	Associate	2690069
Pancreatitis	Associate	16467158, 3181427, 31922743
Parkinson Disease	Associate	34882862
Plaque Amyloid	Associate	10931181, 27607147
Plaque Amyloid	Stimulate	11395927
Prostatic Neoplasms	Associate	36774376
Protein Aggregation Pathological	Associate	16467158
Renal Insufficiency	Associate	29526462
Tauopathies	Associate	34759019
Varicella Zoster Virus Infection	Stimulate	34759019
Ventricular Fibrillation	Associate	19475663

IAPP (islet amyloid polypeptide)