Gene Gene information from NCBI Gene database.
Entrez ID 3375
Gene name Islet amyloid polypeptide
Gene symbol IAPP
Synonyms (NCBI Gene)
DAPIAP
Chromosome 12
Chromosome location 12p12.1
Summary This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type
miRNA miRNA information provided by mirtarbase database.
161
miRTarBase ID miRNA Experiments Reference
MIRT018914 hsa-miR-335-5p Microarray 18185580
MIRT030101 hsa-miR-26b-5p Microarray 19088304
MIRT440479 hsa-miR-376a-3p HITS-CLIP 24374217
MIRT440477 hsa-miR-432-5p HITS-CLIP 24374217
MIRT440476 hsa-miR-1185-2-3p HITS-CLIP 24374217
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
GATA4 Activation 17290010
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
55
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding TAS 22500019
GO:0005102 Function Signaling receptor binding IPI 22500019
GO:0005102 Function Signaling receptor binding TAS 2608057, 10342886
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
147940 5329 ENSG00000121351
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10997
Protein name Islet amyloid polypeptide (IAPP) (Amylin) (Diabetes-associated peptide) (DAP) (Insulinoma amyloid peptide)
Protein function Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affe
PDB 1KUW , 2G48 , 2KB8 , 2L86 , 3DG1 , 3FPO , 3FR1 , 3FTH , 3FTK , 3FTL , 3FTR , 3G7V , 3G7W , 3HGZ , 5K5G , 5KNZ , 5KO0 , 5MGQ , 6UCJ , 6UCK , 6VW2 , 6Y1A , 6ZRF , 6ZRQ , 6ZRR , 7BG0 , 7M61 , 7M62 , 7M64 , 7M65 , 7YKW , 7YL0 , 7YL3 , 7YL7 , 8AWT , 8AZ0 , 8AZ1 , 8AZ2 , 8AZ3 , 8AZ4 , 8AZ5 , 8AZ6 , 8AZ7 , 8F0J , 8F0K , 8F2A , 8F2B , 8R4I , 8YG2 , 9GZ6 , 9GZP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00214 Calc_CGRP_IAPP 25 75 Calcitonin / CGRP / IAPP family Family
Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNA
VEVLKREPLNYLPL
Sequence length 89
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling
Maturity onset diabetes of the young
  G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Amyloid fiber formation