Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3363
Gene name Gene Name - the full gene name approved by the HGNC.
5-hydroxytryptamine receptor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HTR7
Synonyms (NCBI Gene) Gene synonyms aliases
5-HT7
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.31
Summary Summary of gene provided in NCBI Entrez Gene.
The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involveme
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016917 hsa-miR-335-5p Microarray 18185580
MIRT528508 hsa-miR-5580-3p PAR-CLIP 21572407
MIRT528507 hsa-miR-1246 PAR-CLIP 21572407
MIRT528506 hsa-miR-490-5p PAR-CLIP 21572407
MIRT528505 hsa-miR-4301 PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004993 Function G protein-coupled serotonin receptor activity IBA 21873635
GO:0005515 Function Protein binding IPI 19486527, 30021884
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
GO:0006939 Process Smooth muscle contraction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
182137 5302 ENSG00000148680
Protein
UniProt ID P34969
Protein name 5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7)
Protein function G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:8226867). Ligand binding causes a conformation change that triggers signali
PDB 7XTC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 98 384 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: [Isoform A]: Predominant isoform in spleen, caudate and hippocampus. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform B]: Expressed at lower levels. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform D]: Minor isofo
Sequence
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIY
AFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Sequence length 479
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
  Serotonin receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Myopathy Myopathy rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166
View all (81 more)
17600820
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
12165372
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic 18712364, 19649616, 23276605, 20097233, 22843252, 21859099 ClinVar
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Alcoholism Associate 21184583
Mental Disorders Associate 7601444
Migraine Disorders Associate 22678113