Gene Gene information from NCBI Gene database.
Entrez ID 3363
Gene name 5-hydroxytryptamine receptor 7
Gene symbol HTR7
Synonyms (NCBI Gene)
5-HT7
Chromosome 10
Chromosome location 10q23.31
Summary The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involveme
miRNA miRNA information provided by mirtarbase database.
124
miRTarBase ID miRNA Experiments Reference
MIRT016917 hsa-miR-335-5p Microarray 18185580
MIRT528508 hsa-miR-5580-3p PAR-CLIP 21572407
MIRT528507 hsa-miR-1246 PAR-CLIP 21572407
MIRT528506 hsa-miR-490-5p PAR-CLIP 21572407
MIRT528505 hsa-miR-4301 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004993 Function G protein-coupled serotonin receptor activity IBA
GO:0004993 Function G protein-coupled serotonin receptor activity IDA 8226867, 35714614
GO:0004993 Function G protein-coupled serotonin receptor activity IEA
GO:0005515 Function Protein binding IPI 19486527, 30021884
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
182137 5302 ENSG00000148680
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P34969
Protein name 5-hydroxytryptamine receptor 7 (5-HT-7) (5-HT7) (5-HT-X) (Serotonin receptor 7)
Protein function G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35714614, PubMed:8226867). Ligand binding causes a conformation change that triggers signali
PDB 7XTC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 98 384 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: [Isoform A]: Predominant isoform in spleen, caudate and hippocampus. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform B]: Expressed at lower levels. {ECO:0000269|PubMed:9084407}.; TISSUE SPECIFICITY: [Isoform D]: Minor isofo
Sequence
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIY
AFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Sequence length 479
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
  Serotonin receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production