Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3361
Gene name	5-hydroxytryptamine receptor 5A
Gene symbol	HTR5A
Synonyms (NCBI Gene)	5-HT5A
Chromosome	7
Chromosome location	7q36.2
Summary	The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotoni

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments
MIRT1057302	hsa-miR-1224-5p	CLIP-seq
MIRT1057303	hsa-miR-1304	CLIP-seq
MIRT1057304	hsa-miR-216a	CLIP-seq
MIRT1057305	hsa-miR-216b	CLIP-seq
MIRT1057306	hsa-miR-3120-5p	CLIP-seq
MIRT1057307	hsa-miR-3125	CLIP-seq
MIRT1057308	hsa-miR-3150b-3p	CLIP-seq
MIRT1057309	hsa-miR-3169	CLIP-seq
MIRT1057310	hsa-miR-3646	CLIP-seq
MIRT1057311	hsa-miR-3662	CLIP-seq
MIRT1057312	hsa-miR-3674	CLIP-seq
MIRT1057313	hsa-miR-3915	CLIP-seq
MIRT1057314	hsa-miR-3916	CLIP-seq
MIRT1057315	hsa-miR-3977	CLIP-seq
MIRT1057316	hsa-miR-4273	CLIP-seq
MIRT1057317	hsa-miR-4283	CLIP-seq
MIRT1057318	hsa-miR-4317	CLIP-seq
MIRT1057319	hsa-miR-433	CLIP-seq
MIRT1057320	hsa-miR-4489	CLIP-seq
MIRT1057321	hsa-miR-4515	CLIP-seq
MIRT1057322	hsa-miR-4677-5p	CLIP-seq
MIRT1057323	hsa-miR-4689	CLIP-seq
MIRT1057324	hsa-miR-4698	CLIP-seq
MIRT1057325	hsa-miR-4732-5p	CLIP-seq
MIRT1057326	hsa-miR-4784	CLIP-seq
MIRT1057327	hsa-miR-488	CLIP-seq
MIRT1057328	hsa-miR-511	CLIP-seq
MIRT1057329	hsa-miR-548g	CLIP-seq
MIRT1057330	hsa-miR-618	CLIP-seq
MIRT1057331	hsa-miR-877	CLIP-seq
MIRT2013096	hsa-miR-208a	CLIP-seq
MIRT2013097	hsa-miR-208b	CLIP-seq
MIRT2013098	hsa-miR-3617	CLIP-seq
MIRT2013099	hsa-miR-3658	CLIP-seq
MIRT2013100	hsa-miR-4312	CLIP-seq
MIRT2013101	hsa-miR-499-5p	CLIP-seq
MIRT2013102	hsa-miR-617	CLIP-seq
MIRT2013103	hsa-miR-641	CLIP-seq
MIRT1057308	hsa-miR-3150b-3p	CLIP-seq
MIRT1057323	hsa-miR-4689	CLIP-seq
MIRT1057326	hsa-miR-4784	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	9865521, 35610220, 35835867
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	7988681
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	7988681
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9865521
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	9865521
GO:0005886	Component	Plasma membrane	TAS	7988681
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7988681
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	34239069
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	9865521, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0032355	Process	Response to estradiol	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	9865521
GO:0099589	Function	Serotonin receptor activity	IEA
GO:0099634	Component	Postsynaptic specialization membrane	IEA

MIM	HGNC	e!Ensembl
601305	5300	ENSG00000157219

P47898

Protein name

5-hydroxytryptamine receptor 5A (5-HT-5) (5-HT-5A) (5-HT5A) (Serotonin receptor 5A)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone and a mitogen (PubMed:35610220, PubMed:35835867, PubMed:9865521). Also functions as a receptor for ergot alkaloid

PDB

7UM4 , 7UM5 , 7UM6 , 7UM7 , 7X5H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 338	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Sequence length

357

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse		Serotonin receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Melanoma	Benign	rs149473122	RCV005902455
Prostate cancer	Uncertain significance	rs193920930	RCV000149304

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Autistic Disorder	Associate	17203304
Glioma	Associate	20388841
Intracranial Hypertension	Stimulate	27487831
Neuroblastoma	Associate	39217334

HTR5A (5-hydroxytryptamine receptor 5A)