Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3359
Gene name	5-hydroxytryptamine receptor 3A
Gene symbol	HTR3A
Synonyms (NCBI Gene)	5-HT-35-HT3A5-HT3R5HT3RHTR3
Chromosome	11
Chromosome location	11q23.2
Summary	The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021413	hsa-miR-9-5p	Microarray	17612493
MIRT1057238	hsa-miR-3160-3p	CLIP-seq
MIRT1057239	hsa-miR-4307	CLIP-seq
MIRT1057240	hsa-miR-4487	CLIP-seq
MIRT1057241	hsa-miR-4710	CLIP-seq
MIRT1057242	hsa-miR-4792	CLIP-seq
MIRT1057243	hsa-miR-558	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9950429
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	7565620, 9950429, 10521471
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0032154	Component	Cleavage furrow	IDA	19799413
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051378	Function	Serotonin binding	IDA	7565620
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0098662	Process	Inorganic cation transmembrane transport	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	10521471
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IDA	9950429
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	16116092, 17392525

MIM	HGNC	e!Ensembl
182139	5297	ENSG00000166736

P46098

Protein name

5-hydroxytryptamine receptor 3A (5-HT3-A) (5-HT3A) (5-hydroxytryptamine receptor 3) (5-HT-3) (5-HT3R) (Serotonin receptor 3A) (Serotonin-gated ion channel receptor)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,

PDB

8AXD , 8BL8 , 8BLA , 8BLB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	35 → 242	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	249 → 469	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. {ECO:0000269|PubMed:10521471}.

Sequence

MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA

Sequence length

478

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Hepatocellular carcinoma	Benign	rs183698487	RCV005904852

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32736413
Adenocarcinoma Papillary	Stimulate	32736413
Anxiety	Associate	21420406, 22014438, 33767348, 35800179
Anxiety Disorders	Associate	21420406
Asthma	Associate	24338226
Autistic Disorder	Associate	19184136
Bipolar Disorder	Associate	27706728
Colitis Ulcerative	Associate	27022227
Depressive Disorder	Associate	22014438, 33767348, 35800179
Down Syndrome	Associate	27293319
Dyspepsia	Associate	21192076, 22014438
Esophageal Neoplasms	Associate	34022433
Inflammation	Associate	24338226
Irritable Bowel Syndrome	Associate	21192076, 21420406, 35800179
Irritable Bowel Syndrome	Stimulate	27022227
Major Affective Disorder 2	Associate	22832903
Mastodynia	Associate	29723560
Medically Unexplained Symptoms	Associate	35800179
Mental Disorders	Associate	16000636, 22832903
Nausea	Associate	33794950
Neoplasms	Associate	22139646, 27716384, 35757399
Obesity	Associate	33767348
Obsessive Compulsive Disorder	Associate	27616601
Pain	Associate	28002447, 30904518
Parkinson Disease	Stimulate	28057070
Pathophobia	Associate	35105872
Postoperative Nausea and Vomiting	Associate	37924126
Sexual Trauma	Associate	26701104
Thyroid Cancer Papillary	Associate	35757399
Travel Related Illness	Associate	26701104
Vascular Malformations	Associate	27716384

HTR3A (5-hydroxytryptamine receptor 3A)