Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3359
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 3A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR3A
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021413	hsa-miR-9-5p	Microarray	17612493
MIRT1057238	hsa-miR-3160-3p	CLIP-seq
MIRT1057239	hsa-miR-4307	CLIP-seq
MIRT1057240	hsa-miR-4487	CLIP-seq
MIRT1057241	hsa-miR-4710	CLIP-seq
MIRT1057242	hsa-miR-4792	CLIP-seq
MIRT1057243	hsa-miR-558	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq
MIRT1549700	hsa-miR-1587	CLIP-seq
MIRT1549701	hsa-miR-378g	CLIP-seq
MIRT1549702	hsa-miR-4492	CLIP-seq
MIRT1549703	hsa-miR-4498	CLIP-seq
MIRT1549704	hsa-miR-4656	CLIP-seq
MIRT1549705	hsa-miR-4675	CLIP-seq
MIRT1549706	hsa-miR-4691-5p	CLIP-seq
MIRT1549707	hsa-miR-4718	CLIP-seq
MIRT1549708	hsa-miR-4741	CLIP-seq
MIRT1549709	hsa-miR-762	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17392525
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IBA	21873635
GO:0022850	Function	Serotonin-gated cation-selective channel activity	IDA	7565620, 9950429
GO:0030424	Component	Axon	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0032154	Component	Cleavage furrow	IDA	19799413
GO:0032414	Process	Positive regulation of ion transmembrane transporter activity	IEA
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042220	Process	Response to cocaine	IEA
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043025	Component	Neuronal cell body	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0045471	Process	Response to ethanol	IEA
GO:0050877	Process	Nervous system process	IBA	21873635
GO:0051378	Function	Serotonin binding	IDA	7565620
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IDA	9950429

MIM	HGNC	e!Ensembl
182139	5297	ENSG00000166736

Protein

UniProt ID

P46098

Protein name

5-hydroxytryptamine receptor 3A (5-HT3-A) (5-HT3A) (5-hydroxytryptamine receptor 3) (5-HT-3) (5-HT3R) (Serotonin receptor 3A) (Serotonin-gated ion channel receptor)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,

PDB

8AXD , 8BL8 , 8BLA , 8BLB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	35 → 242	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	249 → 469	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. {ECO:0000269|PubMed:10521471}.

Sequence

MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA

Sequence length

478

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	19184136
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20356718, 21184810

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	20694966, 22014438, 21937687, 19741568, 20728877, 16487942	ClinVar
Multiple Sclerosis	Multiple Sclerosis		GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32736413
Adenocarcinoma Papillary	Stimulate	32736413
Anxiety	Associate	21420406, 22014438, 33767348, 35800179
Anxiety Disorders	Associate	21420406
Asthma	Associate	24338226
Autistic Disorder	Associate	19184136
Bipolar Disorder	Associate	27706728
Colitis Ulcerative	Associate	27022227
Depressive Disorder	Associate	22014438, 33767348, 35800179
Down Syndrome	Associate	27293319
Dyspepsia	Associate	21192076, 22014438
Esophageal Neoplasms	Associate	34022433
Inflammation	Associate	24338226
Irritable Bowel Syndrome	Associate	21192076, 21420406, 35800179
Irritable Bowel Syndrome	Stimulate	27022227
Major Affective Disorder 2	Associate	22832903
Mastodynia	Associate	29723560
Medically Unexplained Symptoms	Associate	35800179
Mental Disorders	Associate	16000636, 22832903
Nausea	Associate	33794950
Neoplasms	Associate	22139646, 27716384, 35757399
Obesity	Associate	33767348
Obsessive Compulsive Disorder	Associate	27616601
Pain	Associate	28002447, 30904518
Parkinson Disease	Stimulate	28057070
Pathophobia	Associate	35105872
Postoperative Nausea and Vomiting	Associate	37924126
Sexual Trauma	Associate	26701104
Thyroid Cancer Papillary	Associate	35757399
Travel Related Illness	Associate	26701104
Vascular Malformations	Associate	27716384

HTR3A (5-hydroxytryptamine receptor 3A)