Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3356
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR2A
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT2A, HTR2
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q14.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the receptors for serotonin, a neurotransmitter with many roles. Mutations in this gene are associated with susceptibility to schizophrenia and obsessive-compulsive disorder, and are also associated with response to the antidepres

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs7997012	A>C,G,T	Drug-response, benign	Intron variant

Show/Hide all(105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450850	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450849	hsa-miR-4251	PAR-CLIP	22100165
MIRT450848	hsa-miR-4329	PAR-CLIP	22100165
MIRT450847	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT450846	hsa-miR-4303	PAR-CLIP	22100165
MIRT450845	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT450850	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT450849	hsa-miR-4251	PAR-CLIP	22100165
MIRT450848	hsa-miR-4329	PAR-CLIP	22100165
MIRT450847	hsa-miR-6761-5p	PAR-CLIP	22100165
MIRT450846	hsa-miR-4303	PAR-CLIP	22100165
MIRT450845	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1057200	hsa-miR-1202	CLIP-seq
MIRT1057201	hsa-miR-1257	CLIP-seq
MIRT1057202	hsa-miR-2964a-5p	CLIP-seq
MIRT1057203	hsa-miR-3117-3p	CLIP-seq
MIRT1057204	hsa-miR-3119	CLIP-seq
MIRT1057205	hsa-miR-3169	CLIP-seq
MIRT1057206	hsa-miR-3194-5p	CLIP-seq
MIRT1057207	hsa-miR-34a	CLIP-seq
MIRT1057208	hsa-miR-34c-5p	CLIP-seq
MIRT1057209	hsa-miR-3611	CLIP-seq
MIRT1057210	hsa-miR-3650	CLIP-seq
MIRT1057211	hsa-miR-3677-5p	CLIP-seq
MIRT1057212	hsa-miR-3972	CLIP-seq
MIRT1057213	hsa-miR-4422	CLIP-seq
MIRT1057214	hsa-miR-4460	CLIP-seq
MIRT1057215	hsa-miR-449a	CLIP-seq
MIRT1057216	hsa-miR-449b	CLIP-seq
MIRT1057217	hsa-miR-4727-3p	CLIP-seq
MIRT1057218	hsa-miR-4756-3p	CLIP-seq
MIRT1057219	hsa-miR-4759	CLIP-seq
MIRT1057220	hsa-miR-522	CLIP-seq
MIRT1057221	hsa-miR-676	CLIP-seq
MIRT1057222	hsa-miR-759	CLIP-seq
MIRT2013073	hsa-miR-4698	CLIP-seq
MIRT2245360	hsa-miR-1321	CLIP-seq
MIRT2245361	hsa-miR-140-3p	CLIP-seq
MIRT2245362	hsa-miR-147	CLIP-seq
MIRT2245363	hsa-miR-3137	CLIP-seq
MIRT2245364	hsa-miR-331-3p	CLIP-seq
MIRT2245365	hsa-miR-3649	CLIP-seq
MIRT2245366	hsa-miR-4270	CLIP-seq
MIRT2245367	hsa-miR-4441	CLIP-seq
MIRT2245368	hsa-miR-4739	CLIP-seq
MIRT2245369	hsa-miR-4756-5p	CLIP-seq
MIRT2548588	hsa-miR-1303	CLIP-seq
MIRT2548589	hsa-miR-1322	CLIP-seq
MIRT2548590	hsa-miR-219-5p	CLIP-seq
MIRT2548591	hsa-miR-27a	CLIP-seq
MIRT2548592	hsa-miR-27b	CLIP-seq
MIRT2548593	hsa-miR-302f	CLIP-seq
MIRT2548594	hsa-miR-3120-3p	CLIP-seq
MIRT2548595	hsa-miR-3123	CLIP-seq
MIRT2548596	hsa-miR-3190	CLIP-seq
MIRT2548597	hsa-miR-371b-5p	CLIP-seq
MIRT2548598	hsa-miR-3925-5p	CLIP-seq
MIRT2548599	hsa-miR-4445	CLIP-seq
MIRT2548600	hsa-miR-4473	CLIP-seq
MIRT2548601	hsa-miR-4699-3p	CLIP-seq
MIRT2548602	hsa-miR-4752	CLIP-seq
MIRT2548603	hsa-miR-4782-3p	CLIP-seq
MIRT2548604	hsa-miR-4790-3p	CLIP-seq
MIRT2548605	hsa-miR-499-3p	CLIP-seq
MIRT2548606	hsa-miR-499a-3p	CLIP-seq
MIRT2548607	hsa-miR-508-3p	CLIP-seq
MIRT2548608	hsa-miR-512-3p	CLIP-seq
MIRT2548609	hsa-miR-513a-5p	CLIP-seq
MIRT2548610	hsa-miR-520f	CLIP-seq
MIRT2548611	hsa-miR-642b	CLIP-seq
MIRT2548612	hsa-miR-767-3p	CLIP-seq
MIRT2548613	hsa-miR-875-5p	CLIP-seq
MIRT2548614	hsa-miR-935	CLIP-seq
MIRT2682485	hsa-miR-1306	CLIP-seq
MIRT2548589	hsa-miR-1322	CLIP-seq
MIRT2682486	hsa-miR-1827	CLIP-seq
MIRT2548590	hsa-miR-219-5p	CLIP-seq
MIRT2548591	hsa-miR-27a	CLIP-seq
MIRT2548592	hsa-miR-27b	CLIP-seq
MIRT2548594	hsa-miR-3120-3p	CLIP-seq
MIRT2682487	hsa-miR-3163	CLIP-seq
MIRT2548596	hsa-miR-3190	CLIP-seq
MIRT2682488	hsa-miR-3662	CLIP-seq
MIRT2548597	hsa-miR-371b-5p	CLIP-seq
MIRT2682489	hsa-miR-4436b-5p	CLIP-seq
MIRT2548599	hsa-miR-4445	CLIP-seq
MIRT2548600	hsa-miR-4473	CLIP-seq
MIRT2548601	hsa-miR-4699-3p	CLIP-seq
MIRT2682490	hsa-miR-4735-5p	CLIP-seq
MIRT2548602	hsa-miR-4752	CLIP-seq
MIRT2682491	hsa-miR-4775	CLIP-seq
MIRT2548603	hsa-miR-4782-3p	CLIP-seq
MIRT2548604	hsa-miR-4790-3p	CLIP-seq
MIRT2548605	hsa-miR-499-3p	CLIP-seq
MIRT2548606	hsa-miR-499a-3p	CLIP-seq
MIRT2548607	hsa-miR-508-3p	CLIP-seq
MIRT2548608	hsa-miR-512-3p	CLIP-seq
MIRT2548609	hsa-miR-513a-5p	CLIP-seq
MIRT2548610	hsa-miR-520f	CLIP-seq
MIRT2682492	hsa-miR-590-3p	CLIP-seq
MIRT2548611	hsa-miR-642b	CLIP-seq
MIRT2682493	hsa-miR-659	CLIP-seq
MIRT2548612	hsa-miR-767-3p	CLIP-seq
MIRT2548613	hsa-miR-875-5p	CLIP-seq
MIRT2548614	hsa-miR-935	CLIP-seq

Show/Hide all(89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001587	Function	Gq/11-coupled serotonin receptor activity	IDA	18703043, 35084960
GO:0001618	Function	Virus receptor activity	IEA
GO:0001659	Process	Temperature homeostasis	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	7582481, 15862800
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	9109547
GO:0005515	Function	Protein binding	IPI	14988405, 16537434, 18297054, 28258217, 30157263
GO:0005883	Component	Neurofilament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15862800, 18703043
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9109547
GO:0005901	Component	Caveola	IEA
GO:0006096	Process	Glycolytic process	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	19057895
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IBA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	20966218, 37991948
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IDA	35084960
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IBA
GO:0007210	Process	Serotonin receptor signaling pathway	TAS	9109547
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	9109547
GO:0007613	Process	Memory	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	15862800
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010513	Process	Positive regulation of phosphatidylinositol biosynthetic process	IDA	19057895
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014824	Process	Artery smooth muscle contraction	IEA
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030296	Function	Protein tyrosine kinase activator activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031652	Process	Positive regulation of heat generation	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	19279328, 28258217
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043198	Component	Dendritic shaft	IEA
GO:0043267	Process	Negative regulation of potassium ion transport	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044380	Process	Protein localization to cytoskeleton	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046960	Process	Sensitization	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050951	Process	Sensory perception of temperature stimulus	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	15862800
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	18703043
GO:0051378	Function	Serotonin binding	IDA	7582481, 15831837, 15862800, 18703043, 19057895
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19057895
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070852	Component	Cell body fiber	IEA
GO:0071886	Function	1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding	IDA	19057895
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IDA	16517693, 18703043
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IMP	18703043
GO:0098666	Component	G protein-coupled serotonin receptor complex	IDA	18703043
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	35084960
GO:0099589	Function	Serotonin receptor activity	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1901731	Process	Positive regulation of platelet aggregation	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
182135	5293	ENSG00000102468

Protein

UniProt ID

P28223

Protein name

5-hydroxytryptamine receptor 2A (5-HT-2) (5-HT-2A) (Serotonin receptor 2A)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:1330647, PubMed:18703043, PubMed:19057895, PubMed:21645528, PubMed:22300836, PubMed:35084960, PubMed:38552625). Also functions as a receptor for various drugs and psychoactiv

PDB

6A93 , 6A94 , 6WGT , 6WH4 , 6WHA , 7RAN , 7VOD , 7VOE , 7WC4 , 7WC5 , 7WC6 , 7WC7 , 7WC8 , 7WC9 , 8JT8 , 8UWL , 8V6U , 8ZMG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	91 → 380	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain cortex (at protein level). Detected in blood platelets. {ECO:0000269|PubMed:18297054}.

Sequence

MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV

Sequence length

471

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Gap junction Serotonergic synapse Inflammatory mediator regulation of TRP channels		Serotonin receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Neuroblastoma	Neuroblastoma	N/A	N/A	GWAS
Schizophrenia	Schizophrenia, susceptibility to	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (88)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	33582601
Akathisia Drug Induced	Associate	38377518
Alcoholism	Associate	11287798, 17713649
Alzheimer Disease	Associate	16640790, 17525976, 26303700, 34336000
Anorexia Nervosa	Associate	16087994, 20545463
Antisocial Personality Disorder	Associate	36094569
Anxiety	Associate	23397970, 25041420, 29249830
Anxiety Disorders	Associate	37984468
Arthritis Rheumatoid	Associate	16699051, 20179740, 23254357, 36561742
Asthma	Associate	37238670
Ataxia	Associate	22615781
Auditory Perceptual Disorders	Associate	27230021
Autism Spectrum Disorder	Associate	20628446, 24753316, 24968012
Autistic Disorder	Associate	17203304, 26262902
Behcet Syndrome	Associate	39278467
Bipolar Disorder	Associate	24136241, 27063557, 28751646, 30178121, 31676688, 38377518, 39278467
Bipolar Disorder	Stimulate	30178121
Blood Platelet Disorders	Associate	16179957
Borderline Personality Disorder	Associate	22139575, 24751216
Breast Neoplasms	Associate	35168555
Bruxism	Associate	32367059
Carcinogenesis	Associate	37564635
Cardiomyopathy Dilated	Associate	36472833
Cardiomyopathy Hypertrophic	Stimulate	36657118
Central Nervous System Diseases	Associate	23158458
Conduct Disorder	Associate	23457595
Consciousness Disorders	Associate	30355445
Cystitis Interstitial	Associate	30973927
Delirium	Associate	33086708
Depressive Disorder	Associate	17525976, 19924111, 22228829, 23158458, 23217578, 24959950, 24968012, 25041420, 26262902, 31676688, 37678326, 37984468
Depressive Disorder Major	Associate	20047709
Diffuse Intrinsic Pontine Glioma	Associate	30124166
Disruptive Impulse Control and Conduct Disorders	Associate	11287798, 19493540, 24751216, 29120849
Dyskinesia Drug Induced	Associate	15383158, 22615781
Esophageal Squamous Cell Carcinoma	Associate	34912075
Essential Hypertension	Associate	17713649
Fatigue	Associate	37678326
Fatigue Syndrome Chronic	Associate	20941551
Fatigue Syndrome Chronic	Stimulate	20941551
Feeding and Eating Disorders	Associate	31199591
Glioma	Associate	37564635
Hallucinations	Associate	34684144
Heredodegenerative Disorders Nervous System	Associate	34326453
Hyperprolactinemia	Associate	31520576
Hypertension	Associate	31906879
Hypertension Pulmonary	Associate	10516655
IgA Vasculitis	Associate	16699051
Inflammation	Associate	28809398, 32986378, 36561742, 39472813
Intervertebral Disc Degeneration	Associate	38492610
Kidney Diseases	Associate	15247977
Marijuana Abuse	Associate	23217578
Mental Disorders	Associate	16640790, 23158458, 23808549, 24751216, 24959950, 31199591, 32697408, 34318684
Migraine with Aura	Associate	20930387
Migraine without Aura	Associate	20930387
Mood Disorders	Associate	20043006, 22558144, 39472813
Multiple Sclerosis	Associate	33335118
Myocardial Infarction	Associate	16179957, 17713649
Nasopharyngeal Carcinoma	Associate	32986378
Nasopharyngitis	Associate	32986378
Neoplasms	Associate	19634160, 37564635
Neuroblastoma	Associate	7623119, 9282925, 9831908
Neurodegenerative Diseases	Associate	25041420
Nocturnal Enuresis	Associate	21089166
Obesity	Associate	23544600, 23900445, 24959950, 27228958
Obsessive Compulsive Disorder	Associate	15005715, 19742166, 25041420, 36641432
Obsessive Compulsive Disorder	Stimulate	29042551
Pain	Associate	30904518, 30973927
Panic Disorder	Associate	20817074, 29249830, 32723321
Parkinson Disease	Associate	24398658
Personality Disorders	Associate	19959344, 24751216, 29120849
Psychomotor Agitation	Associate	26303700
Psychotic Disorders	Associate	31676688
Retinoblastoma	Associate	8900237
Schizophrenia	Associate	15383158, 18420180, 25041420, 29032150, 36641432, 37564635
Sleep Apnea Obstructive	Associate	20538960, 32367059
Sleep Bruxism	Associate	32367059
Sleep Wake Disorders	Associate	29883419
Somatoform Disorders	Associate	20403506
Stress Disorders Post Traumatic	Associate	19842167
Substance Related Disorders	Associate	31676688
Substance Related Disorders	Stimulate	36094569
Temporomandibular Joint Disorders	Associate	22074755, 40435063
Thromboembolism	Associate	16179957
Urinary Incontinence	Associate	17713649
Uterine Cervical Neoplasms	Associate	7623119
Virus Diseases	Associate	20660194
Weight Loss	Associate	24959950
Wounds and Injuries	Associate	38377518

HTR2A (5-hydroxytryptamine receptor 2A)