HTR1E (5-hydroxytryptamine receptor 1E)

Gene

• Entrez ID: 3354
• Gene name: 5-hydroxytryptamine receptor 1E
• Gene symbol: HTR1E
• Synonyms (NCBI Gene): 5-HT1E
• Chromosome: 6
• Chromosome location: 6q14.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	33762731
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	1733778
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	1608964
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IMP	21422162
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	1608964
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32814053, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21422162
GO:0005886	Component	Plasma membrane	TAS	1733778
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1608964
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1733778
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	21422162
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	33762731, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	TAS	1608964
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0045202	Component	Synapse	IEA
GO:0051378	Function	Serotonin binding	IDA	1608964
GO:0051378	Function	Serotonin binding	IEA
GO:0099589	Function	Serotonin receptor activity	IDA	33762731
GO:0099589	Function	Serotonin receptor activity	IEA

Other IDs

• MIM: 182132
• HGNC: 5291
• e!Ensembl: ENSG00000168830

Protein

• UniProt ID: P28566
• Protein name: 5-hydroxytryptamine receptor 1E (5-HT-1E) (5-HT1E) (S31) (Serotonin receptor 1E)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:14744596, PubMed:1513320, PubMed:1608964, PubMed:1733778, PubMed:21422162, PubMed:33762731). Also functions as a receptor for various alkaloids and psychoactive substances (P
• PDB: 7E33, 8UGY, 8UH3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	39 → 344	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain. {ECO:0000269|PubMed:14744596}.
• Sequence:

  MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
  ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
  YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
  IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
  TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
  ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
  CREHT

• Sequence length: 365

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction

Reactome:

Serotonin receptors
G alpha (i) signalling events