Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3351
Gene name Gene Name - the full gene name approved by the HGNC.	5-hydroxytryptamine receptor 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HTR1B
Synonyms (NCBI Gene) Gene synonyms aliases	5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and a

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002447	hsa-miR-96-5p	Reporter assay	18283276

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	1348246
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IMP	29925951
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	1315531
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	24722188, 25416956, 25910212, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1652050
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	1315531
GO:0005886	Component	Plasma membrane	TAS	1559993
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1559993
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	8882600
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	1315531, 29925951, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	1351684
GO:0014063	Process	Negative regulation of serotonin secretion	IEA
GO:0014063	Process	Negative regulation of serotonin secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0042310	Process	Vasoconstriction	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0051378	Function	Serotonin binding	IEA
GO:0071312	Process	Cellular response to alkaloid	IDA	1315531
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	1315531
GO:0098666	Component	G protein-coupled serotonin receptor complex	IEA
GO:0099154	Component	Serotonergic synapse	IEA
GO:0099589	Function	Serotonin receptor activity	IEA
GO:0099589	Function	Serotonin receptor activity	IMP	29925951
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	25871906

MIM	HGNC	e!Ensembl
182131	5287	ENSG00000135312

Protein

UniProt ID

P28222

Protein name

5-hydroxytryptamine receptor 1B (5-HT-1B) (5-HT1B) (S12) (Serotonin 1D beta receptor) (5-HT-1D-beta) (Serotonin receptor 1B)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:10452531, PubMed:1315531, PubMed:1328844, PubMed:1348246, PubMed:1351684, PubMed:1559993, PubMed:1565658, PubMed:1610347, PubMed:23519210, PubMed:23519215, PubMed:29925951, P

PDB

4IAQ , 4IAR , 5V54 , 6G79 , 7C61

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	66 → 369	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebral artery smooth muscle cells (at protein level). Detected in brain cortex, striatum, amygdala, medulla, hippocampus, caudate nucleus and putamen. {ECO:0000269|PubMed:1348246, ECO:0000269|PubMed:1351684, ECO:0000269|P

Sequence

MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse Taste transduction		Serotonin receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Postmenopausal breast cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32508318
Adrenocortical Carcinoma	Associate	34220331
Alcoholism	Associate	19736238, 22064162, 22550993
Anorexia Nervosa	Associate	27579596
Anxiety	Associate	27579596
Anxiety Disorders	Associate	27579596
Attention Deficit Disorder with Hyperactivity	Associate	16380908, 22841130
Autistic Disorder	Associate	29904178
Bulimia Nervosa	Associate	27579596
Conduct Disorder	Associate	23457595, 25993020
Death	Associate	34220331
Depressive Disorder	Associate	22064162
Developmental Disabilities	Associate	29904178
Diabetes Mellitus	Associate	29759300
Endometrial Neoplasms	Associate	24623538
Feeding and Eating Disorders	Associate	27579596
Glucosephosphate Dehydrogenase Deficiency	Associate	25677060
Intracranial Aneurysm	Associate	26186006
Leukemia Myelomonocytic Chronic	Associate	30224768
Mental Disorders	Associate	30231895, 33036580
Migraine Disorders	Associate	34979683
Mood Disorders	Associate	29709878
Myelodysplastic Syndromes	Associate	30224768
Neointima	Associate	24074042
Neoplasms	Associate	25170871, 25268648, 39183370
Obesity	Associate	21252242, 22106445
Obsessive Compulsive Disorder	Associate	14731309, 24571444
Pancreatic Neoplasms	Associate	25170871, 25268648
Polycystic Ovary Syndrome	Associate	21252242
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	39183370
Prostatic Neoplasms	Associate	22420486
Schizophrenia	Associate	30231895
Substance Related Disorders	Associate	22841130
Thrombosis	Associate	39183370

HTR1B (5-hydroxytryptamine receptor 1B)