HTR1B (5-hydroxytryptamine receptor 1B)

Gene

• Entrez ID: 3351
• Gene name: 5-hydroxytryptamine receptor 1B
• Gene symbol: HTR1B
• Synonyms (NCBI Gene): 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
• Chromosome: 6
• Chromosome location: 6q14.1
• Summary: The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002447	hsa-miR-96-5p	Reporter assay	18283276

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	1348246
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IMP	29925951
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	1315531
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	24722188, 25416956, 25910212, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1652050
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	1315531
GO:0005886	Component	Plasma membrane	TAS	1559993
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1559993
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	8882600
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	1315531, 29925951, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007208	Process	Phospholipase C-activating serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	1351684
GO:0014063	Process	Negative regulation of serotonin secretion	IEA
GO:0014063	Process	Negative regulation of serotonin secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0042310	Process	Vasoconstriction	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0051378	Function	Serotonin binding	IEA
GO:0071312	Process	Cellular response to alkaloid	IDA	1315531
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	1315531
GO:0098666	Component	G protein-coupled serotonin receptor complex	IEA
GO:0099154	Component	Serotonergic synapse	IEA
GO:0099589	Function	Serotonin receptor activity	IEA
GO:0099589	Function	Serotonin receptor activity	IMP	29925951
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	25871906

Other IDs

• MIM: 182131
• HGNC: 5287
• e!Ensembl: ENSG00000135312

Protein

• UniProt ID: P28222
• Protein name: 5-hydroxytryptamine receptor 1B (5-HT-1B) (5-HT1B) (S12) (Serotonin 1D beta receptor) (5-HT-1D-beta) (Serotonin receptor 1B)
• Protein function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:10452531, PubMed:1315531, PubMed:1328844, PubMed:1348246, PubMed:1351684, PubMed:1559993, PubMed:1565658, PubMed:1610347, PubMed:23519210, PubMed:23519215, PubMed:29925951, P
• PDB: 4IAQ, 4IAR, 5V54, 6G79, 7C61
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 369	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in cerebral artery smooth muscle cells (at protein level). Detected in brain cortex, striatum, amygdala, medulla, hippocampus, caudate nucleus and putamen. {ECO:0000269|PubMed:1348246, ECO:0000269|PubMed:1351684, ECO:0000269|P
• Sequence:

  MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
  LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
  VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
  SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
  KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
  KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
  NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

• Sequence length: 390

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction

Reactome:

Serotonin receptors
G alpha (i) signalling events