Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3350
Gene name	5-hydroxytryptamine receptor 1A
Gene symbol	HTR1A
Synonyms (NCBI Gene)	5-HT-1A5-HT1A5HT1aADRB2RL1ADRBRL1G-21PFMCD
Chromosome	5
Chromosome location	5q12.3
Summary	This gene encodes a G protein-coupled receptor for 5-hydroxytryptamine (serotonin), and belongs to the 5-hydroxytryptamine receptor subfamily. Serotonin has been implicated in a number of physiologic processes and pathologic conditions. Inactivation of th

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6295	C>A,G	Likely-benign, benign, drug-response	Upstream transcript variant
rs367956927	T>-	Pathogenic	5 prime UTR variant

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018705	hsa-miR-335-5p	Microarray	18185580
MIRT438131	hsa-miR-135a-5p	Luciferase reporter assay	24952960
MIRT438131	hsa-miR-135a-5p	Luciferase reporter assay	24952960

Show/Hide all (6)

Transcription factor	Regulation	Reference
DEAF1	Repression	14507979
HES1	Unknown	18499474
HES6	Unknown	18499474
MAZ	Unknown	8626793
PARP1	Repression	21990073
SP1	Unknown	8626793

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IDA	33762731, 37935376, 37935377
GO:0001586	Function	Gi/o-coupled serotonin receptor activity	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001662	Process	Behavioral fear response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IDA	8393041
GO:0004993	Function	G protein-coupled serotonin receptor activity	IEA
GO:0004993	Function	G protein-coupled serotonin receptor activity	IMP	22957663
GO:0004993	Function	G protein-coupled serotonin receptor activity	TAS	9736659
GO:0005515	Function	Protein binding	IPI	22035699, 24157794, 25485703, 26365466
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22957663
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3138543
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	22957663
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1330092
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	8393041, 33762731, 35610220
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	IEA
GO:0007198	Process	Adenylate cyclase-inhibiting serotonin receptor signaling pathway	ISS
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	ISS
GO:0007214	Process	Gamma-aminobutyric acid signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1330092
GO:0014062	Process	Regulation of serotonin secretion	IEA
GO:0014062	Process	Regulation of serotonin secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA
GO:0035640	Process	Exploration behavior	IEA
GO:0035640	Process	Exploration behavior	ISS
GO:0042053	Process	Regulation of dopamine metabolic process	IEA
GO:0042053	Process	Regulation of dopamine metabolic process	ISS
GO:0042428	Process	Serotonin metabolic process	IEA
GO:0042428	Process	Serotonin metabolic process	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0046883	Process	Regulation of hormone secretion	IEA
GO:0050795	Process	Regulation of behavior	IEA
GO:0051378	Function	Serotonin binding	IBA
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:0099589	Function	Serotonin receptor activity	IDA	33762731
GO:0099589	Function	Serotonin receptor activity	IEA

MIM	HGNC	e!Ensembl
109760	5286	ENSG00000178394

P08908

Protein name

5-hydroxytryptamine receptor 1A (5-HT-1A) (5-HT1A) (G-21) (Serotonin receptor 1A)

Protein function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed:22957663, PubMed:3138543, PubMed:33762731, PubMed:37935376, PubMed:37935377, PubMed:8138923, PubMed:8393041). Also functions as a receptor for various drugs and psychoactive

PDB

7E2X , 7E2Y , 7E2Z , 8FY8 , 8FYE , 8FYL , 8FYT , 8FYX , 8JSP , 8JT6 , 8PJK , 8PKM , 8W8B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	53 → 400	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in lymph nodes, thymus and spleen. Detected in activated T-cells, but not in resting T-cells. {ECO:0000269|PubMed:3041227, ECO:0000269|PubMed:8393041}.

Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ

Sequence length

422

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Serotonergic synapse Taste transduction		Serotonin receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
HTR1A-related disorder	Likely benign	rs774406938, rs145641566	RCV003957255 RCV003943124
Menstrual cycle-dependent periodic fever	Uncertain significance; Conflicting classifications of pathogenicity	rs2530978515, rs201899093, rs367956927	RCV003225791 RCV005399389 RCV000024351

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Pain	Associate	39615579
Adenocarcinoma	Associate	26112163
Agoraphobia	Associate	14984628
Alzheimer Disease	Associate	25041947
Anemia Sickle Cell	Associate	39615579
Anxiety	Associate	10585418, 14984628, 19124686, 23408467, 29249830, 33874644
Anxiety Disorders	Associate	18796187, 25514753, 37984468
Attention Deficit Disorder with Hyperactivity	Associate	26079129
Autistic Disorder	Associate	17203304
Autoimmune Diseases	Associate	22563461
Bipolar Disorder	Associate	15458611, 19278673, 23434290, 23926239, 27063557
Borderline Personality Disorder	Associate	18387137
Breast Neoplasms	Associate	35199941
Bulimia Nervosa	Associate	20872754
Carcinoma Non Small Cell Lung	Inhibit	20193080
Carcinoma Non Small Cell Lung	Associate	26112163
Depressive Disorder	Associate	10585418, 14984628, 15458611, 15758168, 16467535, 18796187, 18831910, 19278673, 23269215, 26926882, 28590587, 33874644, 35199941, 37958600, 37984468
Depressive Disorder Major	Associate	14984628, 26926882
Depressive Disorder Major	Inhibit	27661418
Diabetes Mellitus Type 1	Associate	22563461
Disruptive Impulse Control and Conduct Disorders	Associate	20872754, 23269215
Fibromyalgia	Associate	33874644, 36342939
Glycosuria Renal	Associate	17009264
Keloid	Associate	34600545
Leukodystrophy Metachromatic	Associate	18831910
Lung Neoplasms	Associate	26112163
Lupus Erythematosus Systemic	Associate	17009264
Lupus Nephritis	Associate	17009264
Lymphoma	Associate	30862884
Mental Disorders	Associate	19124686, 22328058, 26079129, 26926882, 35760877
Mood Disorders	Associate	15458611, 16467535, 23926239, 29709878, 35760877
Neoplasms	Inhibit	20193080
Neoplasms	Associate	30862884
Neuroblastoma	Associate	37958600
Obesity Metabolically Benign	Associate	35760877
Pain	Associate	33874644, 33980291, 36342939, 38128761, 39615579
Panic Disorder	Associate	15469667, 16316476, 16467535, 20817074, 29249830, 32723321
Parkinson Disease	Associate	25514753
Pathophobia	Associate	25514753
Personality Disorders	Associate	20872754
Premature Ejaculation	Associate	37161455
Schizophrenia	Associate	15469667
Sleep Wake Disorders	Associate	30476041
Stress Disorders Post Traumatic	Associate	23408467, 26926882
Substance Related Disorders	Associate	15469667, 26926882
Syncope	Associate	30636478
Triple Negative Breast Neoplasms	Inhibit	35199941
Wounds and Injuries	Associate	20817074

HTR1A (5-hydroxytryptamine receptor 1A)