SNAI3 (snail family transcriptional repressor 3)

Gene

• Entrez ID: 333929
• Gene name: Snail family transcriptional repressor 3
• Gene symbol: SNAI3
• Synonyms (NCBI Gene): SMUC, SNAIL3, ZNF293, Zfp293
• Chromosome: 16
• Chromosome location: 16q24.2
• Summary: SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054045	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	22402125
MIRT1374805	hsa-miR-4269	CLIP-seq
MIRT1374806	hsa-miR-4733-5p	CLIP-seq
MIRT2111557	hsa-miR-3126-5p	CLIP-seq
MIRT2111558	hsa-miR-326	CLIP-seq
MIRT2111559	hsa-miR-330-5p	CLIP-seq
MIRT2111560	hsa-miR-4459	CLIP-seq
MIRT2111561	hsa-miR-4488	CLIP-seq
MIRT2111562	hsa-miR-4667-5p	CLIP-seq
MIRT2111563	hsa-miR-4697-5p	CLIP-seq
MIRT2111564	hsa-miR-4700-5p	CLIP-seq
MIRT2111565	hsa-miR-4722-5p	CLIP-seq
MIRT2111566	hsa-miR-4779	CLIP-seq
MIRT2111567	hsa-miR-486-3p	CLIP-seq
MIRT2111568	hsa-miR-637	CLIP-seq
MIRT2460082	hsa-miR-125a-5p	CLIP-seq
MIRT2460083	hsa-miR-125b	CLIP-seq
MIRT2460084	hsa-miR-146b-3p	CLIP-seq
MIRT2460085	hsa-miR-3173-5p	CLIP-seq
MIRT2460086	hsa-miR-371b-3p	CLIP-seq
MIRT2460087	hsa-miR-4319	CLIP-seq
MIRT2460088	hsa-miR-4324	CLIP-seq
MIRT2460089	hsa-miR-4329	CLIP-seq
MIRT2460090	hsa-miR-4786-5p	CLIP-seq
MIRT2460091	hsa-miR-769-5p	CLIP-seq
MIRT2460092	hsa-miR-874	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RUNX2	Activation	22641097

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005507	Function	Copper ion binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 612741
• HGNC: 18411
• e!Ensembl: ENSG00000185669

Protein

• UniProt ID: Q3KNW1
• Protein name: Zinc finger protein SNAI3 (Protein snail homolog 3) (Zinc finger protein 293)
• Protein function: Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3' (By similarity). {ECO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	183 → 205	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	209 → 231	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	237 → 259	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	265 → 286	Zinc finger, C2H2 type	Domain

• Sequence:

  MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWD
  RSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVL
  PTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVG
  RVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACS
  HCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP

• Sequence length: 292