Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	333929
Gene name Gene Name - the full gene name approved by the HGNC.	Snail family transcriptional repressor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SNAI3
Synonyms (NCBI Gene) Gene synonyms aliases	SMUC, SNAIL3, ZNF293, Zfp293
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).[supplied by OMIM, Apr 2009]

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054045	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	22402125
MIRT1374805	hsa-miR-4269	CLIP-seq
MIRT1374806	hsa-miR-4733-5p	CLIP-seq
MIRT2111557	hsa-miR-3126-5p	CLIP-seq
MIRT2111558	hsa-miR-326	CLIP-seq
MIRT2111559	hsa-miR-330-5p	CLIP-seq
MIRT2111560	hsa-miR-4459	CLIP-seq
MIRT2111561	hsa-miR-4488	CLIP-seq
MIRT2111562	hsa-miR-4667-5p	CLIP-seq
MIRT2111563	hsa-miR-4697-5p	CLIP-seq
MIRT2111564	hsa-miR-4700-5p	CLIP-seq
MIRT2111565	hsa-miR-4722-5p	CLIP-seq
MIRT2111566	hsa-miR-4779	CLIP-seq
MIRT2111567	hsa-miR-486-3p	CLIP-seq
MIRT2111568	hsa-miR-637	CLIP-seq
MIRT2460082	hsa-miR-125a-5p	CLIP-seq
MIRT2460083	hsa-miR-125b	CLIP-seq
MIRT2460084	hsa-miR-146b-3p	CLIP-seq
MIRT2460085	hsa-miR-3173-5p	CLIP-seq
MIRT2460086	hsa-miR-371b-3p	CLIP-seq
MIRT2460087	hsa-miR-4319	CLIP-seq
MIRT2460088	hsa-miR-4324	CLIP-seq
MIRT2460089	hsa-miR-4329	CLIP-seq
MIRT2460090	hsa-miR-4786-5p	CLIP-seq
MIRT2460091	hsa-miR-769-5p	CLIP-seq
MIRT2460092	hsa-miR-874	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RUNX2	Activation	22641097

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0005507	Function	Copper ion binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IBA	21873635
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612741	18411	ENSG00000185669

Protein

UniProt ID

Q3KNW1

Protein name

Zinc finger protein SNAI3 (Protein snail homolog 3) (Zinc finger protein 293)

Protein function

Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3' (By similarity). {ECO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	183 → 205	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	209 → 231	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	237 → 259	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	265 → 286	Zinc finger, C2H2 type	Domain

Sequence

MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWD
RSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVL
PTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVG
RVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACS
HCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP

Sequence length

292

Interactions

View interactions

SNAI3 (snail family transcriptional repressor 3)