Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3336
Gene name Gene Name - the full gene name approved by the HGNC.	Heat shock protein family E (Hsp10) member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HSPE1
Synonyms (NCBI Gene) Gene synonyms aliases	CPN10, EPF, GROES, HSP10
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an A

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments
MIRT1056772	hsa-miR-1	CLIP-seq
MIRT1056773	hsa-miR-103a	CLIP-seq
MIRT1056774	hsa-miR-107	CLIP-seq
MIRT1056775	hsa-miR-1243	CLIP-seq
MIRT1056776	hsa-miR-1270	CLIP-seq
MIRT1056777	hsa-miR-206	CLIP-seq
MIRT1056778	hsa-miR-3074-3p	CLIP-seq
MIRT1056779	hsa-miR-3163	CLIP-seq
MIRT1056780	hsa-miR-340	CLIP-seq
MIRT1056781	hsa-miR-3673	CLIP-seq
MIRT1056782	hsa-miR-3688-3p	CLIP-seq
MIRT1056783	hsa-miR-3942-3p	CLIP-seq
MIRT1056784	hsa-miR-4261	CLIP-seq
MIRT1056785	hsa-miR-4276	CLIP-seq
MIRT1056786	hsa-miR-4311	CLIP-seq
MIRT1056787	hsa-miR-4496	CLIP-seq
MIRT1056788	hsa-miR-4531	CLIP-seq
MIRT1056789	hsa-miR-4666-5p	CLIP-seq
MIRT1056790	hsa-miR-4699-3p	CLIP-seq
MIRT1056791	hsa-miR-4764-5p	CLIP-seq
MIRT1056792	hsa-miR-4795-3p	CLIP-seq
MIRT1056793	hsa-miR-539	CLIP-seq
MIRT1056794	hsa-miR-613	CLIP-seq
MIRT1056795	hsa-miR-616	CLIP-seq
MIRT1056796	hsa-miR-620	CLIP-seq
MIRT1056797	hsa-miR-624	CLIP-seq
MIRT1056798	hsa-miR-944	CLIP-seq
MIRT1056772	hsa-miR-1	CLIP-seq
MIRT1056773	hsa-miR-103a	CLIP-seq
MIRT1056774	hsa-miR-107	CLIP-seq
MIRT1056777	hsa-miR-206	CLIP-seq
MIRT1056781	hsa-miR-3673	CLIP-seq
MIRT1056783	hsa-miR-3942-3p	CLIP-seq
MIRT1056785	hsa-miR-4276	CLIP-seq
MIRT1056789	hsa-miR-4666-5p	CLIP-seq
MIRT1056790	hsa-miR-4699-3p	CLIP-seq
MIRT1056794	hsa-miR-613	CLIP-seq
MIRT1056798	hsa-miR-944	CLIP-seq
MIRT1056772	hsa-miR-1	CLIP-seq
MIRT1056773	hsa-miR-103a	CLIP-seq
MIRT1056774	hsa-miR-107	CLIP-seq
MIRT1056777	hsa-miR-206	CLIP-seq
MIRT1056781	hsa-miR-3673	CLIP-seq
MIRT1056783	hsa-miR-3942-3p	CLIP-seq
MIRT1056785	hsa-miR-4276	CLIP-seq
MIRT1056789	hsa-miR-4666-5p	CLIP-seq
MIRT1056790	hsa-miR-4699-3p	CLIP-seq
MIRT1056794	hsa-miR-613	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	9989505, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10205158
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	TAS	7698325
GO:0006986	Process	Response to unfolded protein	TAS	7698325
GO:0016020	Component	Membrane	HDA	16210410
GO:0044183	Function	Protein folding chaperone	IEA
GO:0046872	Function	Metal ion binding	IBA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	NAS	7916212, 12483302
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IPI	10205158
GO:0051087	Function	Protein-folding chaperone binding	TAS	7698325
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097193	Process	Intrinsic apoptotic signaling pathway	NAS	10205158

MIM	HGNC	e!Ensembl
600141	5269	ENSG00000115541

Protein

UniProt ID

P61604

Protein name

10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) (Early-pregnancy factor) (EPF) (Heat shock protein family E member 1)

Protein function

Co-chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp60, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolde

PDB

4PJ1 , 6HT7 , 6MRC , 6MRD , 8G7N , 8G7O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00166	Cpn10	8 → 100	Chaperonin 10 Kd subunit	Domain

Sequence

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEI
QPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Sequence length

102

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (45)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Stimulate	28275270
Adenocarcinoma	Associate	27491302
Adenocarcinoma	Stimulate	39267762
Adenocarcinoma of Lung	Associate	32986659, 38017020
Adenoma	Associate	27491302
Alzheimer Disease	Associate	26687188
Arthritis Rheumatoid	Associate	17457039
Astrocytoma	Associate	29028811
Ataxia Telangiectasia	Associate	26429916
Carcinogenesis	Stimulate	12860287
Carcinogenesis	Associate	17048249, 27491302, 32927708
Carcinogenesis	Inhibit	17457039
Carcinoma Basal Cell	Associate	17048249
Carcinoma Non Small Cell Lung	Associate	32986659
Carcinoma Renal Cell	Associate	24504108
Carcinoma Squamous Cell	Associate	17048249
Cataract	Associate	37511188
Colitis Ulcerative	Associate	22297444
Colorectal Neoplasms	Associate	17457039, 33971488
Coronary Artery Disease	Associate	17052347
Diabetes Mellitus Type 2	Associate	18229457
Fallopian Tube Diseases	Associate	10603402
Infections	Associate	12738647, 17052347, 24599530
Infertility	Associate	12738647
Inflammation	Associate	23028910
Leprosy	Associate	9746595
Lymphatic Metastasis	Associate	16253146
Lymphoma Mantle Cell	Associate	15650054
Mitochondrial Diseases	Associate	25390895
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Associate	9334218
Neoplasms	Associate	17457039, 18500265, 25355063, 29028811, 32986659, 39267762
Neoplasms Glandular and Epithelial	Associate	17048249
Neuroblastoma	Associate	25390895
Neurogenic Bowel	Associate	16253146
Ovarian Neoplasms	Associate	17419711, 18500265
Parkinson Disease	Associate	35258800
Pregnancy Ectopic	Associate	28275270
Prostatitis	Stimulate	17457039
Pulmonary Disease Chronic Obstructive	Inhibit	17048249
Pulmonary Disease Chronic Obstructive	Associate	25355063
Reproductive Tract Infections	Associate	10603402
Retinal Dysplasia	Associate	17048249
Sleep Deprivation	Inhibit	25390895
Stomach Neoplasms	Associate	16769709
Whooping Cough	Associate	24599530

HSPE1 (heat shock protein family E (Hsp10) member 1)