Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3329
Gene name	Heat shock protein family D (Hsp60) member 1
Gene symbol	HSPD1
Synonyms (NCBI Gene)	CPN60GROELHLD4HSP-60HSP60HSP65HuCHA60SPG13
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria.

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61755731	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs66468541	C>T	Pathogenic	Coding sequence variant, missense variant
rs863224042	T>C	Likely-pathogenic	Coding sequence variant, missense variant

389

Show/Hide all (389)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	17715156
MIRT003976	hsa-miR-1-3p	Review	19815577
MIRT003976	hsa-miR-1-3p	Luciferase reporter assay	23226300
MIRT003976	hsa-miR-1-3p	Proteomics	18668040
MIRT024960	hsa-miR-214-3p	Microarray;Other	19859982
MIRT031799	hsa-miR-16-5p	Proteomics	18668040
MIRT048142	hsa-miR-197-3p	CLASH	23622248
MIRT045988	hsa-miR-125b-5p	CLASH	23622248
MIRT043359	hsa-miR-331-3p	CLASH	23622248
MIRT043032	hsa-miR-324-5p	CLASH	23622248
MIRT037397	hsa-miR-744-5p	CLASH	23622248
MIRT037397	hsa-miR-744-5p	CLASH	23622248
MIRT618514	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT618513	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT618512	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT618511	hsa-miR-4513	HITS-CLIP	23824327
MIRT618510	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT618509	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT618508	hsa-miR-3167	HITS-CLIP	23824327
MIRT618507	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT618506	hsa-miR-134-5p	HITS-CLIP	23824327
MIRT618505	hsa-miR-3118	HITS-CLIP	23824327
MIRT618504	hsa-miR-1297	HITS-CLIP	23824327
MIRT618503	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618502	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618501	hsa-miR-4465	HITS-CLIP	23824327
MIRT618500	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT618499	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT618498	hsa-miR-4439	HITS-CLIP	23824327
MIRT618497	hsa-miR-498	HITS-CLIP	23824327
MIRT618496	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT618514	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT618513	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT618512	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT618511	hsa-miR-4513	HITS-CLIP	23824327
MIRT618510	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT618509	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT618508	hsa-miR-3167	HITS-CLIP	23824327
MIRT618507	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT618506	hsa-miR-134-5p	HITS-CLIP	23824327
MIRT618505	hsa-miR-3118	HITS-CLIP	23824327
MIRT618504	hsa-miR-1297	HITS-CLIP	23824327
MIRT618503	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT618502	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT618501	hsa-miR-4465	HITS-CLIP	23824327
MIRT618500	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT618499	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT618498	hsa-miR-4439	HITS-CLIP	23824327
MIRT618497	hsa-miR-498	HITS-CLIP	23824327
MIRT618496	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056737	hsa-miR-1244	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056745	hsa-miR-3941	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056753	hsa-miR-466	CLIP-seq
MIRT1056754	hsa-miR-4668-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056756	hsa-miR-4672	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT1056762	hsa-miR-548c-3p	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056764	hsa-miR-556-3p	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT2012999	hsa-miR-4272	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056736	hsa-miR-1	CLIP-seq
MIRT1056700	hsa-miR-1229	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056702	hsa-miR-1261	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056738	hsa-miR-1912	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056739	hsa-miR-206	CLIP-seq
MIRT1056707	hsa-miR-2277-3p	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056740	hsa-miR-31	CLIP-seq
MIRT1056741	hsa-miR-3130-5p	CLIP-seq
MIRT1056710	hsa-miR-3137	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056714	hsa-miR-323b-5p	CLIP-seq
MIRT1056715	hsa-miR-3622b-5p	CLIP-seq
MIRT1056716	hsa-miR-3682-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT2245294	hsa-miR-382	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056745	hsa-miR-3941	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056747	hsa-miR-4307	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056749	hsa-miR-4482	CLIP-seq
MIRT1056721	hsa-miR-4528	CLIP-seq
MIRT1056722	hsa-miR-4639-3p	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056753	hsa-miR-466	CLIP-seq
MIRT1056754	hsa-miR-4668-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056756	hsa-miR-4672	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056724	hsa-miR-4684-5p	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056757	hsa-miR-4720-3p	CLIP-seq
MIRT1056727	hsa-miR-4731-3p	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056729	hsa-miR-4801	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056764	hsa-miR-556-3p	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056766	hsa-miR-613	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056770	hsa-miR-873	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056735	hsa-miR-944	CLIP-seq
MIRT1056742	hsa-miR-323-5p	CLIP-seq
MIRT1056743	hsa-miR-3688-5p	CLIP-seq
MIRT1056746	hsa-miR-4299	CLIP-seq
MIRT1056748	hsa-miR-4456	CLIP-seq
MIRT1056758	hsa-miR-4802-3p	CLIP-seq
MIRT1056759	hsa-miR-4804-3p	CLIP-seq
MIRT1056760	hsa-miR-488	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056763	hsa-miR-548q	CLIP-seq
MIRT1056768	hsa-miR-643	CLIP-seq
MIRT1056769	hsa-miR-760	CLIP-seq
MIRT1056771	hsa-miR-876-3p	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056730	hsa-miR-505	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq
MIRT1056701	hsa-miR-1245	CLIP-seq
MIRT1056703	hsa-miR-128	CLIP-seq
MIRT1056704	hsa-miR-141	CLIP-seq
MIRT1056705	hsa-miR-1587	CLIP-seq
MIRT1056706	hsa-miR-200a	CLIP-seq
MIRT1056708	hsa-miR-27a	CLIP-seq
MIRT1056709	hsa-miR-27b	CLIP-seq
MIRT1056711	hsa-miR-3157-5p	CLIP-seq
MIRT1056712	hsa-miR-3189-3p	CLIP-seq
MIRT1056713	hsa-miR-3194-5p	CLIP-seq
MIRT1056717	hsa-miR-3915	CLIP-seq
MIRT1056744	hsa-miR-3921	CLIP-seq
MIRT1056718	hsa-miR-3928	CLIP-seq
MIRT1056719	hsa-miR-4312	CLIP-seq
MIRT1056720	hsa-miR-4421	CLIP-seq
MIRT2013000	hsa-miR-4422	CLIP-seq
MIRT1056750	hsa-miR-4653-5p	CLIP-seq
MIRT1056751	hsa-miR-4659a-3p	CLIP-seq
MIRT1056752	hsa-miR-4659b-3p	CLIP-seq
MIRT1056755	hsa-miR-4670-3p	CLIP-seq
MIRT1056723	hsa-miR-4674	CLIP-seq
MIRT1056725	hsa-miR-4691-3p	CLIP-seq
MIRT1056726	hsa-miR-4710	CLIP-seq
MIRT1056728	hsa-miR-4792	CLIP-seq
MIRT1056761	hsa-miR-515-5p	CLIP-seq
MIRT1056731	hsa-miR-516a-3p	CLIP-seq
MIRT2013001	hsa-miR-548ag	CLIP-seq
MIRT2013002	hsa-miR-548ai	CLIP-seq
MIRT1056732	hsa-miR-548m	CLIP-seq
MIRT1056765	hsa-miR-579	CLIP-seq
MIRT1056767	hsa-miR-617	CLIP-seq
MIRT1056733	hsa-miR-635	CLIP-seq
MIRT1056734	hsa-miR-942	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Repression	17956589

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	IDA	17164250
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002039	Function	P53 binding	IPI	18086682
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IDA	16148103
GO:0002842	Process	Positive regulation of T cell mediated immune response to tumor cell	IDA	10663613
GO:0003688	Function	DNA replication origin binding	ISS
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0005515	Function	Protein binding	IPI	15846844, 17110338, 17823127, 18086682, 21516116, 21988832, 22664726, 23349634, 23840630, 24286120, 25416956, 25609649, 25910212, 26618866, 26871637, 28514442, 29568061, 29924966, 30021884, 31515488, 32296183, 32814053, 33961781, 35156780, 36012204
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IDA	18229457
GO:0005737	Component	Cytoplasm	IDA	21328542
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17823127, 18086682, 21245038
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	7865888
GO:0005759	Component	Mitochondrial matrix	IDA	19393246, 24746669
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	17823127
GO:0005769	Component	Early endosome	IDA	11807771
GO:0005829	Component	Cytosol	IDA	17823127, 18086682
GO:0005886	Component	Plasma membrane	IDA	11027668
GO:0005905	Component	Clathrin-coated pit	IDA	11807771
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006458	Process	'de novo' protein folding	ISS
GO:0006986	Process	Response to unfolded protein	IDA	11050098
GO:0008035	Function	High-density lipoprotein particle binding	IDA	11027668
GO:0008637	Process	Apoptotic mitochondrial changes	IBA
GO:0009409	Process	Response to cold	ISS
GO:0009986	Component	Cell surface	IDA	9243807, 10663613, 11807771
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	ISS
GO:0019899	Function	Enzyme binding	IPI	20507888
GO:0030135	Component	Coated vesicle	IDA	11807771
GO:0030141	Component	Secretory granule	IEA
GO:0030141	Component	Secretory granule	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078, 21753002
GO:0032727	Process	Positive regulation of interferon-alpha production	IBA
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	17164250
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IBA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	17164250
GO:0032729	Process	Positive regulation of type II interferon production	IDA	17164250
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	16148103
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	17164250
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	16148103
GO:0032991	Component	Protein-containing complex	IDA	21328542, 23349634
GO:0034185	Function	Apolipoprotein binding	IPI	11027668
GO:0034186	Function	Apolipoprotein A-I binding	IPI	11027668
GO:0034514	Process	Mitochondrial unfolded protein response	IBA
GO:0042026	Process	Protein refolding	IDA	11050098
GO:0042026	Process	Protein refolding	IEA
GO:0042100	Process	B cell proliferation	IDA	16148103
GO:0042110	Process	T cell activation	IBA
GO:0042110	Process	T cell activation	IDA	15371451, 17164250
GO:0042110	Process	T cell activation	IEA
GO:0042113	Process	B cell activation	IDA	16148103
GO:0043032	Process	Positive regulation of macrophage activation	IDA	17164250
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18086682
GO:0043231	Component	Intracellular membrane-bounded organelle	IEA
GO:0044406	Process	Adhesion of symbiont to host	IDA	20633027
GO:0045041	Process	Protein import into mitochondrial intermembrane space	IBA
GO:0046696	Component	Lipopolysaccharide receptor complex	IDA	17164250
GO:0048291	Process	Isotype switching to IgG isotypes	IDA	16148103
GO:0050821	Process	Protein stabilization	IMP	18086682
GO:0050821	Process	Protein stabilization	ISS
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IDA	16148103, 17164250
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051082	Function	Unfolded protein binding	IC	11050098
GO:0051082	Function	Unfolded protein binding	ISS
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IPI	10205158
GO:0051131	Process	Chaperone-mediated protein complex assembly	ISS
GO:0051604	Process	Protein maturation	ISS
GO:0051702	Process	Biological process involved in interaction with symbiont	IMP	20507888
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0097225	Component	Sperm midpiece	IMP	32791035
GO:0097524	Component	Sperm plasma membrane	IEA
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0140494	Component	Migrasome	IEA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IDA	17823127
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1900118	Process	Negative regulation of execution phase of apoptosis	IMP	17823127
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IMP	17823127

MIM	HGNC	e!Ensembl
118190	5261	ENSG00000144381

P10809

Protein name

60 kDa heat shock protein, mitochondrial (EC 5.6.1.7) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP-60) (Hsp60) (Heat shock protein family D member 1) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)

Protein function

Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded p

PDB

4PJ1 , 6HT7 , 6MRC , 6MRD , 7AZP , 7L7S , 8G7J , 8G7K , 8G7L , 8G7M , 8G7N , 8G7O , 8U39

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	47 → 550	TCP-1/cpn60 chaperonin family	Family

Sequence

MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF

Sequence length

573

Interactions

View interactions

	KEGG		Reactome
	RNA degradation Type I diabetes mellitus Legionellosis Tuberculosis Lipid and atherosclerosis		Mitochondrial protein import TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

297

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hereditary spastic paraplegia 13	Pathogenic	rs66468541, rs775037805	RCV000019112 RCV000680223
HSPD1-related disorder	Likely pathogenic	rs2470123138	RCV003412418
Hypomyelinating leukodystrophy 4	Pathogenic; Likely pathogenic	rs72466451, rs2086193735	RCV000019113 RCV001254923
Leukodystrophy	Pathogenic	rs72466451	RCV005245481

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs762688563	RCV005868618
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	rs139649754	RCV005899498
Hereditary spastic paraplegia	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	rs755920309, rs184516277, rs2106070461, rs2106076413, rs2086128764, rs557196021, rs2106075505, rs8539, rs11551349, rs1050347, rs189395138, rs41265953, rs11551346, rs111401572, rs141357756 View all (6 more)	RCV001848454 RCV001848455 RCV001848456 RCV001848458 RCV001848459 RCV001848460 RCV001848461 RCV001847688 RCV001847689 RCV001847690 RCV001847745 RCV001847746 RCV001847747 RCV001847748 RCV001847878 RCV001847956 RCV001848675 RCV001848790 RCV000515926 RCV001849138 RCV001847170
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	rs139649754	RCV005899497
Spastic paraplegia	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs184516277, rs2086074548, rs2086171680, rs780655407, rs748662234, rs2106079354, rs879486164, rs1402469498, rs755920309, rs2086045656, rs757619883, rs1390512592, rs1211601466, rs8539, rs11551349 View all (167 more)	RCV001315925 RCV001326675 RCV001341277 RCV001367580 RCV001437615 RCV001505698 RCV002538565 RCV003772274 RCV003772381 RCV002014859 RCV001867542 RCV001878251 RCV001902753 RCV000860062 RCV001081749 RCV000860063 RCV001890769 RCV001933162 RCV002029733 RCV002008395 RCV001908628 RCV000459800 RCV000469114 RCV000233769 RCV000474775 RCV000205928 RCV001866582 RCV002016431 RCV001947586 RCV001936875 RCV002047401 RCV001978356 RCV001934173 RCV002089200 RCV002080434 RCV002080481 RCV002153798 RCV002186235 RCV002079121 RCV002110775 RCV002102609 RCV002179739 RCV002178312 RCV002204871 RCV002204975 RCV002129048 RCV002300284 RCV002298375 RCV000168086 RCV003058758 RCV003068664 RCV003068665 RCV003062373 RCV003062829 RCV003072092 RCV003079258 RCV003095840 RCV003099073 RCV003092155 RCV003092156 RCV002632582 RCV002606927 RCV002636922 RCV002651002 RCV002629486 RCV002634012 RCV003110381 RCV003118435 RCV002580946 RCV002590765 RCV002626760 RCV002715553 RCV002725919 RCV002726067 RCV002710688 RCV002721711 RCV002721775 RCV002730576 RCV002746041 RCV002766315 RCV002786166 RCV002780350 RCV002780981 RCV002756323 RCV002785398 RCV002801544 RCV002820271 RCV002821014 RCV002829939 RCV002835349 RCV002875642 RCV002871939 RCV002909042 RCV002927602 RCV002919112 RCV000460895 RCV001088351 RCV002904795 RCV002952848 RCV002914845 RCV002975810 RCV002942659 RCV002517300 RCV002999602 RCV003059488 RCV003044451 RCV003049123 RCV003036608 RCV000205667 RCV000205074 RCV000231961 RCV000228658 RCV003750961 RCV000476543 RCV001319252 RCV002521353 RCV000540092 RCV003588966 RCV003589656 RCV003589663 RCV003589575 RCV003589881 RCV003588617 RCV003590550 RCV003590857 RCV003590826 RCV003588127 RCV003589099 RCV003590028 RCV003590446 RCV003591024 RCV003751048 RCV003751049 RCV003751707 RCV003752162 RCV003752355 RCV003752501 RCV003752567 RCV003750429 RCV003750432 RCV003751359 RCV003751344 RCV003811194 RCV003825669 RCV003836063 RCV003849603 RCV003857881 RCV003864551 RCV003873213 RCV002522594 RCV002522670 RCV000863075 RCV000464620 RCV000457978 RCV000473495 RCV001326732 RCV003588640 RCV000525374 RCV001454152 RCV000633022 RCV000633027 RCV000817234 RCV000819690 RCV003750824 RCV001088313 RCV001391688 RCV002536784 RCV001400996 RCV001858547 RCV002062255 RCV000868470 RCV002064649 RCV001399679 RCV001480938 RCV001395387 RCV000983868 RCV001050713 RCV001062123 RCV001043856 RCV003769658 RCV001464884 RCV001295710 RCV003588720 RCV001209512 RCV001232457 RCV001227906
Spastic paraplegia, autosomal dominant	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	rs777031722, rs886055390, rs34519984	RCV000312267 RCV000309916 RCV000403275

Show/Hide Text Mining Associations (172)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	23028910
Adenocarcinoma	Associate	23839491, 27491302, 28178129
Adenocarcinoma of Lung	Associate	33640883, 37189138, 37694354, 38017020
Adenoma	Associate	27491302
Alzheimer Disease	Associate	39201760
Antiphospholipid Syndrome	Associate	18759277
Aortic Aneurysm Thoracic	Associate	36291095
Aortic Valve Stenosis	Associate	15120829
Arthritis	Associate	1316935, 7883993
Arthritis Juvenile	Associate	12847694, 1316935, 7883993
Arthritis Reactive	Associate	10640771, 23705835, 8608642
Arthritis Rheumatoid	Associate	10692038, 11048656, 17457039, 7632088, 8608642
Asthma	Associate	19913588
Astrocytoma	Associate	10701837
Atherosclerosis	Associate	10021466, 10203577, 21798264, 22901435, 24347824, 25654359, 26078803, 28604836, 29151033, 32196617, 35308005, 7664485, 8099471, 9250400
Atrial Remodeling	Associate	17688193
Autoimmune Diseases	Associate	10203577, 11882035, 1979591, 33196989, 7913951
Autoimmune Diseases	Stimulate	8778028
Behcet Syndrome	Associate	15196263, 15654836, 15654837
Biliary Tract Diseases	Associate	8666687
Brain Neoplasms	Associate	25269047
Breast Neoplasms	Associate	28591216, 30365075
Buruli Ulcer	Associate	21072233
Cachexia	Associate	35563712
Carcinogenesis	Associate	12860287, 15957980, 17048249, 19568603, 27491302, 37694354
Carcinogenesis	Inhibit	17457039
Carcinoma Basal Cell	Associate	17048249, 28178129
Carcinoma Hepatocellular	Associate	15810071, 26137588, 33307168, 36291095
Carcinoma Non Small Cell Lung	Associate	28178129, 32986659
Carcinoma Ovarian Epithelial	Associate	27460076
Carcinoma Renal Cell	Inhibit	31112866
Carcinoma Squamous Cell	Associate	31222140
Cardiomyopathy Dilated	Associate	7901255
Cardiovascular Diseases	Associate	32739154
Carotid Stenosis	Associate	25654359
Cerebral Infarction	Associate	21206505
Cerebral Palsy	Associate	18571143
Charcot Marie Tooth Disease Recessive Intermediate A	Associate	15708314
Chlamydial Pneumonia	Associate	17848980
Cholangiocarcinoma	Stimulate	23118872
Cholangitis Sclerosing	Stimulate	8666687
Chondroma	Associate	11079732
Chronic Disease	Associate	18240224, 28976240
Cicatrix	Associate	8809130
Cognition Disorders	Associate	37211381
Colitis Ulcerative	Associate	1424286, 22297444
Colorectal Neoplasms	Associate	17457039, 20164542, 20433702, 23004678, 28347227, 33971488, 36499558
Colorectal Neoplasms	Stimulate	21973086
Connective Tissue Diseases	Associate	11048656
Coronary Artery Disease	Associate	17052347, 18229457, 39445733
Coronary Disease	Associate	16297172, 18320357
COVID 19	Associate	34975885
Crohn Disease	Stimulate	1424286
Crohn Disease	Associate	16618609
Demyelinating Autoimmune Diseases CNS	Associate	18571143
Dermatitis Atopic	Associate	22869467
Dermatomyositis	Associate	18240224, 28183315
Diabetes Mellitus	Associate	28591216, 29867058, 7913951
Diabetes Mellitus	Stimulate	29134442
Diabetes Mellitus Type 2	Associate	18229457
Diabetes Mellitus Type 2	Stimulate	20067962
Disease	Associate	10680751
Drug Related Side Effects and Adverse Reactions	Inhibit	26700624, 31861692
Drug Related Side Effects and Adverse Reactions	Associate	28698656
Esophageal Neoplasms	Associate	36889194
Fanconi Anemia	Associate	34954697
Gallbladder Neoplasms	Associate	33261560
Gardner Syndrome	Associate	29682763
Gastrointestinal Neoplasms	Associate	16618609
Glaucoma Open Angle	Associate	30899261
Glioblastoma	Associate	17233837, 27325206
Glomerulonephritis IGA	Associate	10354275
Graft vs Host Disease	Associate	35486633
Heart Failure	Associate	22702715
Hematologic Diseases	Associate	28698656
Heredodegenerative Disorders Nervous System	Associate	18571143
HIV Infections	Stimulate	23028910, 31779701
Hypercholesterolemia	Associate	39445733
Hypersensitivity Immediate	Associate	33196989
Immune System Diseases	Associate	23028910
Infections	Associate	10371470, 17052347, 1979591, 20876294, 37827383
Inflammation	Associate	10021466, 15120829, 15654837, 21206505, 21889313, 22258649, 22869467, 23028910, 28976240, 29134442, 38087324, 8099471
Inflammation	Stimulate	32876904
Inflammatory Bowel Diseases	Associate	1424286
Intracranial Arterial Diseases	Associate	17665428
Kidney Diseases	Stimulate	18229449
Kidney Neoplasms	Inhibit	31112866
Leprosy Lepromatous	Associate	7524076
Leukemia	Associate	20694586
Leukemia Monocytic Acute	Stimulate	29134442
Leukemia Myeloid Acute	Associate	24885082
Leukodystrophy Hypomyelinating 2	Associate	18571143
Leukodystrophy Hypomyelinating 4	Associate	18571143, 21717087, 33076433
Leukodystrophy Metachromatic	Associate	18571143
Lipid Metabolism Disorders	Associate	34557266
Liver Cirrhosis Biliary	Associate	7526135
Liver Cirrhosis Biliary	Stimulate	8666687
Lung Neoplasms	Associate	19657000, 26700624, 28178129, 37694354
Lupus Erythematosus Systemic	Associate	11048656, 8608642
Lymphatic Metastasis	Associate	16253146, 25207654
Lymphatic Metastasis	Stimulate	31222140, 37661276
Lymphoma B Cell Marginal Zone	Associate	9708209
Melanoma	Associate	21792879, 22872370
Metaphyseal chondrodysplasia Schmid type	Associate	10383388
Mitochondrial Diseases	Associate	11959456, 18086682, 21717087, 21769504, 26700624
Mucocutaneous Lymph Node Syndrome	Associate	19950419
Multiple Myeloma	Associate	22350072, 32155663
Multiple Sclerosis	Associate	1374907
Muscular Atrophy	Associate	35563712
Myasthenia Gravis	Associate	22258649
Mycobacterium Infections	Associate	21880973
Mycobacterium Infections Nontuberculous	Associate	22042395
Myocardial Ischemia	Associate	7901255
Necrosis	Associate	17201177
Neoplasm Metastasis	Inhibit	26948660
Neoplasm Metastasis	Associate	29080556, 31222140
Neoplasms	Associate	10663613, 14730689, 15791579, 15957980, 16253146, 17457039, 18086682, 22028587, 23082721, 23839491, 24099319, 25207654, 25265318, 26700624, 26810190 View all (14 more)
Neoplasms	Inhibit	17048249
Neoplasms	Stimulate	32155663, 37087461
Neoplasms Glandular and Epithelial	Associate	17048249
Neuroblastoma	Associate	18797883, 30609639, 31963896
Neurodegenerative Diseases	Associate	18571143, 21717087, 31444388, 31861692, 32739154
Neurogenic Bowel	Associate	16253146
Neuroinflammatory Diseases	Associate	39201760
Neuromuscular Diseases	Associate	31444388
Obesity	Stimulate	24986468
Obesity	Associate	39593105
Osteosarcoma	Associate	24015183
Ovarian Diseases	Associate	39593105
Ovarian Neoplasms	Associate	23429486, 25265318, 34557266, 37087461, 39593105
Ovarian Neoplasms	Stimulate	31477750
Pelizaeus Merzbacher Disease	Associate	18571143
Pelizaeus Merzbacher like disease autosomal recessive 2	Associate	18571143
Periodontal Diseases	Associate	11882035, 11953387, 16542362
Periodontitis	Associate	11882035, 11953387
Periodontitis	Stimulate	16542362
Plaque Atherosclerotic	Associate	10021466, 15699420
Pneumonia Mycoplasma	Associate	15708314
Polycystic Ovary Syndrome	Associate	34480296, 38256230
Precancerous Conditions	Associate	27836734
Prostatic Neoplasms	Associate	16705742, 23661456, 29682763, 35241511
Prostatitis	Associate	17457039
Pulmonary Disease Chronic Obstructive	Associate	17048249, 22140545, 22829758, 28976240
Pyruvate Dehydrogenase Complex Deficiency Disease	Associate	29445841
Q Fever	Associate	33072625
Renal Insufficiency Chronic	Stimulate	24113772
Renal Insufficiency Chronic	Associate	24347824
Respiratory Distress Syndrome	Stimulate	22321564
Rheumatic Diseases	Associate	11048656
Rheumatic Heart Disease	Associate	24738046
Rupture	Associate	29151033
Sjogren's Syndrome	Associate	11048656
Spastic paraplegia 13 autosomal dominant	Associate	18571143
Spastic Paraplegia Hereditary	Associate	11898127, 18400758, 21717087, 31444388, 36316435
Spondylitis Ankylosing	Associate	23424650, 23705835
Squamous Cell Carcinoma of Head and Neck	Associate	31222140, 33232279, 37661276
Status Asthmaticus	Associate	19913588
Stomach Diseases	Associate	26810190
Stomach Neoplasms	Associate	19203381, 25207654, 26646027, 26810190, 26928021, 27644641, 35635169
Takayasu Arteritis	Associate	15544635, 17665428, 7906697
Thrombosis	Associate	18759277
Tongue Neoplasms	Associate	14730689
Tuberculosis Pulmonary	Associate	22042395
Urinary Bladder Neoplasms	Associate	12942564
Uterine Cervical Neoplasms	Associate	19568603
Vaginosis Bacterial	Associate	10371470
Vascular Diseases	Associate	26078803
Vascular System Injuries	Associate	7906697
Ventricular Remodeling	Associate	31467116
von Willebrand Disease Type 2	Associate	25365350
Vulvovaginitis	Associate	10371470
Whooping Cough	Stimulate	21170113

HSPD1 (heat shock protein family D (Hsp60) member 1)