Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3315
Gene name Gene Name - the full gene name approved by the HGNC.	Heat shock protein family B (small) member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HSPB1
Synonyms (NCBI Gene) Gene synonyms aliases	CMT2F, HEL-S-102, HMN2B, HMND3, HS.76067, HSP27, HSP28, Hsp25, SRP27
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct

Show/Hide all(30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1049324	G>A,T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs28937568	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs28937569	C>T	Pathogenic	Missense variant, coding sequence variant
rs28939680	C>A,G,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs28939681	C>T	Pathogenic	Missense variant, coding sequence variant
rs29001571	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, missense variant
rs104894020	C>T	Pathogenic	Missense variant, coding sequence variant
rs121909112	C>G	Pathogenic	Missense variant, coding sequence variant
rs121909113	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs150110356	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant, stop gained
rs367662394	G>A,C,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs375244209	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs557327165	C>G,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs558882005	A>G	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs587781250	G>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs770272088	G>A,C,T	Pathogenic, uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs774585320	C>A,G,T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs777201941	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs780878780	C>A,G,T	Likely-pathogenic	Coding sequence variant, missense variant, synonymous variant
rs863225022	G>A,C,T	Uncertain-significance, pathogenic-likely-pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs863225023	C>T	Pathogenic, likely-pathogenic, uncertain-significance	Coding sequence variant, stop gained
rs1060503021	GC>CT	Likely-pathogenic	Stop gained, coding sequence variant
rs1064795077	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1064796370	->C	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1422978230	C>G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs1554614648	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1554614680	A>-	Likely-pathogenic, uncertain-significance	Coding sequence variant, frameshift variant
rs1563651698	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1583964560	->GCGCCCT	Pathogenic	Coding sequence variant, frameshift variant
rs1583966508	A>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(102)

miRTarBase ID	miRNA	Experiments
MIRT1056380	hsa-miR-1273g	CLIP-seq
MIRT1056381	hsa-miR-1908	CLIP-seq
MIRT1056382	hsa-miR-1909	CLIP-seq
MIRT1056383	hsa-miR-214	CLIP-seq
MIRT1056384	hsa-miR-3133	CLIP-seq
MIRT1056385	hsa-miR-3545-3p	CLIP-seq
MIRT1056386	hsa-miR-3612	CLIP-seq
MIRT1056387	hsa-miR-3619-5p	CLIP-seq
MIRT1056388	hsa-miR-3945	CLIP-seq
MIRT1056389	hsa-miR-4253	CLIP-seq
MIRT1056390	hsa-miR-4467	CLIP-seq
MIRT1056391	hsa-miR-4651	CLIP-seq
MIRT1056392	hsa-miR-4676-5p	CLIP-seq
MIRT1056393	hsa-miR-4723-5p	CLIP-seq
MIRT1056394	hsa-miR-539	CLIP-seq
MIRT1056395	hsa-miR-541	CLIP-seq
MIRT1056396	hsa-miR-552	CLIP-seq
MIRT1056397	hsa-miR-575	CLIP-seq
MIRT1056398	hsa-miR-577	CLIP-seq
MIRT1056399	hsa-miR-580	CLIP-seq
MIRT1056400	hsa-miR-608	CLIP-seq
MIRT1056401	hsa-miR-650	CLIP-seq
MIRT1056402	hsa-miR-654-5p	CLIP-seq
MIRT1056403	hsa-miR-663	CLIP-seq
MIRT1056404	hsa-miR-761	CLIP-seq
MIRT1056405	hsa-miR-876-3p	CLIP-seq
MIRT1056382	hsa-miR-1909	CLIP-seq
MIRT1056383	hsa-miR-214	CLIP-seq
MIRT1056387	hsa-miR-3619-5p	CLIP-seq
MIRT1056388	hsa-miR-3945	CLIP-seq
MIRT1056389	hsa-miR-4253	CLIP-seq
MIRT1056390	hsa-miR-4467	CLIP-seq
MIRT1056391	hsa-miR-4651	CLIP-seq
MIRT1056392	hsa-miR-4676-5p	CLIP-seq
MIRT1056395	hsa-miR-541	CLIP-seq
MIRT1056397	hsa-miR-575	CLIP-seq
MIRT1056400	hsa-miR-608	CLIP-seq
MIRT1056402	hsa-miR-654-5p	CLIP-seq
MIRT1056404	hsa-miR-761	CLIP-seq
MIRT1056380	hsa-miR-1273g	CLIP-seq
MIRT1056381	hsa-miR-1908	CLIP-seq
MIRT1056382	hsa-miR-1909	CLIP-seq
MIRT1056383	hsa-miR-214	CLIP-seq
MIRT1056385	hsa-miR-3545-3p	CLIP-seq
MIRT1056386	hsa-miR-3612	CLIP-seq
MIRT1056387	hsa-miR-3619-5p	CLIP-seq
MIRT1056388	hsa-miR-3945	CLIP-seq
MIRT1056389	hsa-miR-4253	CLIP-seq
MIRT1056390	hsa-miR-4467	CLIP-seq
MIRT1056391	hsa-miR-4651	CLIP-seq
MIRT1056392	hsa-miR-4676-5p	CLIP-seq
MIRT1056393	hsa-miR-4723-5p	CLIP-seq
MIRT1056394	hsa-miR-539	CLIP-seq
MIRT1056395	hsa-miR-541	CLIP-seq
MIRT1056396	hsa-miR-552	CLIP-seq
MIRT1056397	hsa-miR-575	CLIP-seq
MIRT1056398	hsa-miR-577	CLIP-seq
MIRT1056399	hsa-miR-580	CLIP-seq
MIRT1056400	hsa-miR-608	CLIP-seq
MIRT1056401	hsa-miR-650	CLIP-seq
MIRT1056402	hsa-miR-654-5p	CLIP-seq
MIRT1056403	hsa-miR-663	CLIP-seq
MIRT1056404	hsa-miR-761	CLIP-seq
MIRT1056381	hsa-miR-1908	CLIP-seq
MIRT1056382	hsa-miR-1909	CLIP-seq
MIRT1056383	hsa-miR-214	CLIP-seq
MIRT1056384	hsa-miR-3133	CLIP-seq
MIRT1056386	hsa-miR-3612	CLIP-seq
MIRT1056387	hsa-miR-3619-5p	CLIP-seq
MIRT1056388	hsa-miR-3945	CLIP-seq
MIRT1056389	hsa-miR-4253	CLIP-seq
MIRT1056390	hsa-miR-4467	CLIP-seq
MIRT1056391	hsa-miR-4651	CLIP-seq
MIRT1056392	hsa-miR-4676-5p	CLIP-seq
MIRT1056393	hsa-miR-4723-5p	CLIP-seq
MIRT1056395	hsa-miR-541	CLIP-seq
MIRT1056396	hsa-miR-552	CLIP-seq
MIRT1056397	hsa-miR-575	CLIP-seq
MIRT1056398	hsa-miR-577	CLIP-seq
MIRT1056400	hsa-miR-608	CLIP-seq
MIRT1056401	hsa-miR-650	CLIP-seq
MIRT1056402	hsa-miR-654-5p	CLIP-seq
MIRT1056403	hsa-miR-663	CLIP-seq
MIRT1056404	hsa-miR-761	CLIP-seq
MIRT1056381	hsa-miR-1908	CLIP-seq
MIRT1056382	hsa-miR-1909	CLIP-seq
MIRT1056383	hsa-miR-214	CLIP-seq
MIRT1056386	hsa-miR-3612	CLIP-seq
MIRT1056387	hsa-miR-3619-5p	CLIP-seq
MIRT1056388	hsa-miR-3945	CLIP-seq
MIRT1056389	hsa-miR-4253	CLIP-seq
MIRT1056390	hsa-miR-4467	CLIP-seq
MIRT1056391	hsa-miR-4651	CLIP-seq
MIRT1056392	hsa-miR-4676-5p	CLIP-seq
MIRT1056393	hsa-miR-4723-5p	CLIP-seq
MIRT1056395	hsa-miR-541	CLIP-seq
MIRT1056397	hsa-miR-575	CLIP-seq
MIRT1056400	hsa-miR-608	CLIP-seq
MIRT1056401	hsa-miR-650	CLIP-seq
MIRT1056402	hsa-miR-654-5p	CLIP-seq
MIRT1056403	hsa-miR-663	CLIP-seq
MIRT1056404	hsa-miR-761	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ESR1	Activation	10960840
STAT3	Activation	14715258

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	ISS
GO:0001533	Component	Cornified envelope	IEA
GO:0001932	Process	Regulation of protein phosphorylation	IMP	23728742
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	ISS
GO:0005515	Function	Protein binding	IPI	11003656, 12601044, 14594798, 15161933, 16169070, 17184779, 17342744, 18330356, 20467437, 20618440, 21157431, 21575178, 22365833, 23188086, 23948568, 25036637, 25241761, 25277244, 26496610, 28514442, 32814053, 33961781, 37776851
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19464326
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19464326, 28144995
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10859165, 16130169
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	16130169
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006446	Process	Regulation of translational initiation	TAS	10859165
GO:0006457	Process	Protein folding	IMP	20178975, 23948568
GO:0006986	Process	Response to unfolded protein	NAS	1560006
GO:0006986	Process	Response to unfolded protein	TAS	10859165
GO:0008426	Function	Protein kinase C inhibitor activity	IEA
GO:0008426	Function	Protein kinase C inhibitor activity	ISS
GO:0009408	Process	Response to heat	IBA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010506	Process	Regulation of autophagy	NAS	25962073
GO:0019901	Function	Protein kinase binding	IPI	8774846
GO:0030018	Component	Z disc	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035556	Process	Intracellular signal transduction	IMP	18440775
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	18440775
GO:0042026	Process	Protein refolding	IBA
GO:0042802	Function	Identical protein binding	IMP	20178975, 23948568
GO:0042802	Function	Identical protein binding	IPI	11003656, 15581903, 22365833, 25036637, 25277244
GO:0042803	Function	Protein homodimerization activity	IDA	28144995
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043130	Function	Ubiquitin binding	ISS
GO:0043292	Component	Contractile muscle fiber	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	18440775
GO:0044183	Function	Protein folding chaperone	IMP	20178975
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18440775
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	18440775
GO:0051082	Function	Unfolded protein binding	IBA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10386584
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0090038	Process	Negative regulation of protein kinase C signaling	IEA
GO:0090038	Process	Negative regulation of protein kinase C signaling	ISS
GO:0099641	Process	Anterograde axonal protein transport	IMP	23728742
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	ISS
GO:1904115	Component	Axon cytoplasm	IEA
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	18440775
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
602195	5246	ENSG00000106211

Protein

UniProt ID

P04792

Protein name

Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Heat shock protein family B member 1) (Stress-responsive protein 27) (SRP27)

Protein function

Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state (PubMed:10383393, PubMed:20178975). Plays a role in stress resistance and actin organization (PubMed:19166925)

PDB

2N3J , 3Q9P , 3Q9Q , 4MJH , 6DV5 , 6GJH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00011	HSP20	87 → 184	Hsp20/alpha crystallin family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum

Sequence

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK

Sequence length

205

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway VEGF signaling pathway Amoebiasis		VEGFA-VEGFR2 Pathway AUF1 (hnRNP D0) binds and destabilizes mRNA MAPK6/MAPK4 signaling Extra-nuclear estrogen signaling

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	rs557327165, rs121909112, rs587781250, rs28937568, rs1583964560, rs28939680, rs863225022, rs1240900244, rs863225023, rs1422978230, rs1583966508, rs770272088	N/A
Charcot-Marie-Tooth disease	Charcot-Marie-Tooth disease axonal type 2F	rs863225022, rs121909112, rs29001571, rs1060503021, rs28937568, rs766728475, rs587781250, rs1064796370, rs1064795077, rs28937569, rs1554614680, rs28939680, rs28939681, rs863225023, rs1422978230 View all (5 more)	N/A
Distal Hereditary Motor Neuronopathy	distal hereditary motor neuropathy type 2, Neuronopathy, distal hereditary motor, type 2B	rs770272088, rs28937568, rs557327165, rs121909113, rs1064796370, rs28937569, rs28939680, rs104894020, rs121909112, rs29001571	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Distal Spinal Muscular Atrophy	distal spinal muscular atrophy	N/A	N/A	ClinVar
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (207)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	28275270
Adenocarcinoma	Inhibit	10027336, 25230790
Adenocarcinoma	Associate	15882177, 21966358, 22911792, 37010714
Adenocarcinoma of Lung	Associate	21858536
Adenoma Pleomorphic	Inhibit	25230790
Alcoholic Neuropathy	Associate	33973728
Alopecia	Associate	35545365
Alzheimer Disease	Associate	25332170, 35276041, 37010714, 37735671, 38554950
Amyotrophic Lateral Sclerosis	Associate	27492805
Amyotrophic lateral sclerosis 1	Associate	19335999
Arteriosclerosis Obliterans	Associate	36474716
Astrocytoma	Associate	10701837, 25155585, 29550762
Astrocytoma	Stimulate	22806482
Atherosclerosis	Associate	40018940
Atrial Fibrillation	Stimulate	17688193
Barrett Esophagus	Inhibit	10027336
Barrett Esophagus	Associate	12482203
Blood Platelet Disorders	Associate	26046355
Brain Ischemia	Stimulate	23334892
Brain Ischemia	Associate	31783528
Breast Neoplasms	Associate	16033076, 16340246, 21279488, 22384035, 22907762, 23724044, 24816797, 25519015, 29699584, 29954368, 31827382, 31839604, 35235182, 37268925, 8334681
Breast Neoplasms	Inhibit	27555231
Breast Neoplasms	Stimulate	37454220
Bronchiolitis Obliterans Syndrome	Stimulate	20456980
Burkitt Lymphoma	Associate	12967475
Calcinosis Cutis	Associate	35341390
Carcinogenesis	Associate	12200599, 21119665, 29062135, 37010714
Carcinoma Adenoid Cystic	Associate	29424489
Carcinoma Ductal Breast	Associate	23264215
Carcinoma Hepatocellular	Associate	15810071, 16224158, 19161326, 19331697, 19901540, 21888831, 34288818
Carcinoma Large Cell	Associate	24344017
Carcinoma Non Small Cell Lung	Associate	18383892, 22608953, 24804299, 31115576, 35526007, 35931945
Carcinoma Non Small Cell Lung	Stimulate	29062135
Carcinoma Ovarian Epithelial	Associate	19930842, 38310132
Carcinoma Ovarian Epithelial	Stimulate	24061637
Carcinoma Pancreatic Ductal	Associate	22004109, 32200459, 34955688
Carcinoma Renal Cell	Associate	24504108, 27806310
Carcinoma Small Cell	Associate	27540972
Carcinoma Squamous Cell	Associate	21196872, 22500095
Cardiovascular Diseases	Associate	28237841
Cataract	Associate	23950959
Charcot Marie Tooth Disease	Associate	20157854, 20178975, 23728742, 26556829, 28379183, 29330367, 29381233, 30257968, 30669930, 33644875, 36139461, 36539320
Charcot Marie Tooth disease Type 2B	Associate	21892769, 28828227
Charcot Marie Tooth disease Type 2F	Associate	23728742, 28828227, 29381233, 33943041, 33973728, 36291591, 38578345
Charcot Marie Tooth disease X linked recessive 2	Associate	37540114
Cholangiocarcinoma	Associate	18154639
Cholangiocarcinoma	Stimulate	22051775
Cholesteatoma	Associate	23852020
Cholesteatoma Middle Ear	Associate	23852020
Chondroma	Associate	11079732
Chondrosarcoma	Associate	11079732
Cognition Disorders	Associate	38502899
Colorectal Neoplasms	Associate	12633846, 17395183, 21521691, 22799385, 23004678, 28182330, 28347227, 28671249, 30755640, 30915129, 38166604, 8647109
Coronary Artery Disease	Associate	35152560
Death	Associate	25193387
Demyelinating Diseases	Associate	26694816
Diabetes Complications	Associate	18390793
Diabetes Mellitus	Associate	23894433, 26046355, 28237841, 29381233, 39848169
Diabetes Mellitus Type 2	Associate	26046355
Diabetic Retinopathy	Associate	23209562
Disease	Associate	18390793
Distal Hereditary Motor Neuropathy Type II	Associate	17663003, 20157854, 20178975, 23728742, 25088881, 27816334, 28000086, 28828227, 29381233, 30669930, 33943041, 33973728, 35328016, 36291591, 38578345
Distal Myopathies	Associate	28828227
Drug Related Side Effects and Adverse Reactions	Associate	17173546, 21364669, 28337643, 38179774
Dysplastic Nevus Syndrome	Associate	19497117
Endometriosis	Associate	15882177
Epilepsy	Stimulate	15571513
Esophageal Neoplasms	Associate	35053196
Esophageal Squamous Cell Carcinoma	Associate	29099815, 35053196
Fever	Associate	16033076, 20569108, 22004109
Fever	Stimulate	18608577, 23027359
Fibrocystic Breast Disease	Associate	23264215
Friedreich Ataxia 1	Associate	40432442
Gait Ataxia	Associate	33973728, 38578345
Gaucher Disease	Associate	25583479
Genetic Diseases Inborn	Associate	20157854, 25965061, 29330367, 33644875
Genital Neoplasms Female	Associate	15882177
Giant Cell Tumors	Associate	26782567
Glioblastoma	Associate	24902789, 26108672, 29550762, 31073903, 32409605, 37158834
Glioma	Associate	22114076, 22480225, 27711253, 29627902, 34068110, 37158834, 37211949
Glucose Intolerance	Associate	29381233
Graft Occlusion Vascular	Associate	15976317
Granulosa cell tumor of the ovary	Associate	26782567
Hand Arm Vibration Syndrome	Stimulate	38302542
Haspeslagh Fryns Muelenaere syndrome	Associate	24715760
Heart Diseases	Associate	21545686
Heart Failure	Associate	21545686
Hereditary Myopathy with Early Respiratory Failure	Associate	36539320
Hereditary Sensory and Motor Neuropathy	Associate	35328016, 37540114
Hirschsprung Disease	Associate	24773279
HIV Infections	Associate	17622316
Huntington Disease	Associate	36971475
Hypesthesia	Associate	33973728
Hypoxia Brain	Associate	36674983
Infections	Associate	15115286, 18221537
Inflammation	Associate	21935477, 30166342, 31827382, 40018940
Inherited Peripheral Neuropathy	Associate	29381233, 35328016
Insulin Resistance	Associate	23894433
Ischemic Stroke	Associate	23334892
Keratoconus	Associate	31467338
Kidney Diseases	Associate	38096952
Laryngeal Neoplasms	Associate	27540972
Leukemia	Associate	1998499, 20694586, 21364669, 8287974
Leukemia Lymphocytic Chronic B Cell	Associate	12586635, 20007907
Leukemia Myeloid Acute	Associate	15911090, 24885082
Lung Diseases	Inhibit	27555231
Lung Neoplasms	Associate	26872057, 29062135, 32576196
Lymphatic Metastasis	Associate	19497117, 25519015, 27540972, 29099815
Lymphatic Metastasis	Stimulate	24569473, 29062135
Lymphoma Mantle Cell	Associate	19670095
Lymphoma Primary Effusion	Associate	36835344
Machado Joseph Disease	Inhibit	12832059
Melanoma	Associate	14984058, 15491326, 28182330
Melanoma Cutaneous Malignant	Associate	35232428
MERRF Syndrome	Associate	22742457
Mitochondrial Diseases	Stimulate	37433777
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	35499078
Monosomy	Associate	21114636
Motor Neuron Disease	Associate	20157854
Multiple Myeloma	Associate	17173546, 19383903
Multiple Sclerosis	Associate	15571513, 30014472, 31004050, 37735671, 38003363
Multiple Sclerosis	Stimulate	26694816
Multiple Trauma	Associate	40432442
Muscle Cramp	Associate	28828227
Muscle Weakness	Associate	36291591, 38578345
Muscular Atrophy	Associate	38578345
Muscular Diseases	Associate	23950959
Myocardial Infarction	Stimulate	31783528
Myofibrillar Myopathy	Associate	15978589
Nasopharyngeal Carcinoma	Associate	17184779, 22160175, 31115576
Necrosis	Associate	17201177
Neointima	Inhibit	29298892
Neoplasm Metastasis	Associate	24344017, 24804299, 25019299, 27540972, 28182330, 30704117, 34129932, 37010714, 37268925
Neoplasm Metastasis	Stimulate	29332450, 37454220
Neoplasm Metastasis	Inhibit	32200459, 36822455
Neoplasms	Associate	11448946, 12226095, 14730689, 14984058, 15491326, 16033076, 16224158, 16234246, 16340246, 18401453, 19203381, 20007907, 20035555, 20104618, 20540527 View all (47 more)
Neoplasms	Stimulate	12200599, 29062135, 37454220
Neoplasms	Inhibit	25230790
Neoplasms Squamous Cell	Associate	21119665, 22298307
Neoplastic Syndromes Hereditary	Associate	25965061, 27816334, 29381233
Nerve Degeneration	Associate	19335999, 25088881, 29133339
Nervous System Diseases	Associate	27816334, 30669930, 33973728, 37540114
Neurodegenerative Diseases	Associate	27492805
Neuronopathy Distal Hereditary Motor Type V	Associate	17663003, 21892769
Nevus	Associate	15491326
Non alcoholic Fatty Liver Disease	Associate	30344796
Obesity	Associate	23894433, 28237841
Oligodendroglioma	Associate	22806482
Osteoporosis	Associate	26063949
Osteosarcoma	Stimulate	23027359
Osteosarcoma	Associate	29592877
Ovarian Diseases	Associate	19930842
Ovarian Neoplasms	Associate	15304155, 19930842, 28325957, 38310132
Pancreatic Neoplasms	Associate	22004109, 22116673, 25331547, 26895107, 29695571, 29936456
Pancreatitis	Associate	36671463
Paraparesis	Associate	33973728
Paraplegia	Associate	37510225
Parkinson Disease	Associate	37735671
Pemphigus	Associate	37940861
Periodontitis	Associate	35901060
Peripheral Nervous System Diseases	Associate	20178975, 29330367, 30669930, 35328016
Peritoneal Neoplasms	Associate	23508575
Peritonitis	Stimulate	24061637
Peroneal Neuropathies	Associate	28379183
Pituitary Neoplasms	Stimulate	37241117
Polycystic Ovary Syndrome	Inhibit	24391762
Polycystic Ovary Syndrome	Associate	34480296
Pre Eclampsia	Associate	26028931
Precancerous Conditions	Associate	22298307
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1998499
Pregnancy Ectopic	Associate	28275270
Prostatic Neoplasms	Associate	10702402, 16619575, 19707199, 22075945, 23165430, 25193387, 25277244, 26158290, 26175869, 27708246
Prostatitis	Associate	27555231
Pterygium	Associate	24715760
Raynaud Disease	Stimulate	38302542
Rectal Neoplasms	Associate	36414988
Reflex Abnormal	Associate	28828227
Reperfusion Injury	Associate	15115286
Respiratory Distress Syndrome	Associate	34898369
Restless Legs Syndrome	Associate	36291591
Salivary Gland Neoplasms	Associate	39201484
Seckel syndrome 1	Associate	23401567
Seizures	Associate	15571513
Sensorimotor neuropathy with ataxia autosomal dominant	Associate	33943041
Small Cell Lung Carcinoma	Associate	24344017
Spastic paraplegia 17	Associate	17663003
Spinal Cord Diseases	Associate	30014472
Squamous Cell Carcinoma of Head and Neck	Inhibit	16619543
Squamous Cell Carcinoma of Head and Neck	Associate	19497117, 19602232, 20540527, 21196872, 27540972, 32926599, 34498800
ST Elevation Myocardial Infarction	Associate	31783528
Status Asthmaticus	Associate	12482203
Stickler Syndrome Type I Nonsyndromic Ocular	Associate	33973728
Stomach Diseases	Associate	12200599
Stomach Neoplasms	Associate	12200599, 12923326, 19203381, 22860099, 27644641
Stroke	Stimulate	23334892
Takotsubo Cardiomyopathy	Inhibit	26935030
Testicular Neoplasms	Inhibit	7669571
Tetralogy of Fallot	Associate	23080524
Thymic epithelial tumor	Associate	27097982
Tongue Diseases	Associate	19497117
Tongue Neoplasms	Associate	14730689
Urinary Bladder Neoplasms	Associate	12942564, 35945269
Uterine Cervical Dysplasia	Associate	21119665, 24175767
Uterine Cervical Neoplasms	Associate	15882177, 22027750, 24569473, 40197384
Uveal melanoma	Associate	21114636, 22806482, 26305875, 35341390
Ventricular Remodeling	Inhibit	39302489
Virus Diseases	Associate	36557005

HSPB1 (heat shock protein family B (small) member 1)