Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3305
Gene name	Heat shock protein family A (Hsp70) member 1 like
Gene symbol	HSPA1L
Synonyms (NCBI Gene)	HSP70-1LHSP70-HOMHSP70Thum70t
Chromosome	6
Chromosome location	6p21.33
Summary	This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016961	hsa-miR-335-5p	Microarray	18185580
MIRT016961	hsa-miR-335-5p	Microarray	18185580
MIRT028894	hsa-miR-26b-5p	Microarray	19088304
MIRT028894	hsa-miR-26b-5p	Microarray	19088304
MIRT041506	hsa-miR-193b-3p	CLASH	23622248
MIRT2012888	hsa-miR-1237	CLIP-seq
MIRT2012889	hsa-miR-1248	CLIP-seq
MIRT2012890	hsa-miR-128	CLIP-seq
MIRT2012891	hsa-miR-27a	CLIP-seq
MIRT2012892	hsa-miR-27b	CLIP-seq
MIRT2012893	hsa-miR-3919	CLIP-seq
MIRT2012894	hsa-miR-3925-3p	CLIP-seq
MIRT2012895	hsa-miR-3925-5p	CLIP-seq
MIRT2012896	hsa-miR-4643	CLIP-seq
MIRT2012897	hsa-miR-4756-3p	CLIP-seq
MIRT2012898	hsa-miR-513a-5p	CLIP-seq
MIRT2012899	hsa-miR-515-5p	CLIP-seq
MIRT2012900	hsa-miR-766	CLIP-seq
MIRT2012893	hsa-miR-3919	CLIP-seq
MIRT2012895	hsa-miR-3925-5p	CLIP-seq
MIRT2012896	hsa-miR-4643	CLIP-seq
MIRT2012897	hsa-miR-4756-3p	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0005515	Function	Protein binding	IPI	25036637, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	21231916
GO:0005886	Component	Plasma membrane	IBA
GO:0006457	Process	Protein folding	IBA
GO:0006950	Process	Response to stress	IEA
GO:0006986	Process	Response to unfolded protein	TAS	9685725
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0031072	Function	Heat shock protein binding	IBA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031072	Function	Heat shock protein binding	IPI	17182002
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24270810
GO:0042026	Process	Protein refolding	IBA
GO:0042026	Process	Protein refolding	IDA	21231916
GO:0042026	Process	Protein refolding	IEA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0044297	Component	Cell body	IEA
GO:0051082	Function	Unfolded protein binding	IDA	21231916
GO:0051082	Function	Unfolded protein binding	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24270810

MIM	HGNC	e!Ensembl
140559	5234	ENSG00000204390

P34931

Protein name

Heat shock 70 kDa protein 1-like (Heat shock 70 kDa protein 1L) (Heat shock 70 kDa protein 1-Hom) (HSP70-Hom) (Heat shock protein family A member 1L)

Protein function

Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation

PDB

3GDQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00012	HSP70	8 → 614	Hsp70 protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in spermatids. {ECO:0000269|PubMed:9685725}.

Sequence

MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Sequence length

641

Interactions

View interactions

	KEGG		Reactome
	Spliceosome MAPK signaling pathway Protein processing in endoplasmic reticulum Endocytosis Longevity regulating pathway - multiple species Antigen processing and presentation Estrogen signaling pathway Prion disease Legionellosis Toxoplasmosis Measles Lipid and atherosclerosis		Regulation of HSF1-mediated heat shock response HSP90 chaperone cycle for steroid hormone receptors (SHR) Attenuation phase HSF1-dependent transactivation

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Chronic obstructive pulmonary disease	association	rs2227956	RCV000856580
HSPA1L-related disorder	Uncertain significance; Likely benign; Benign	rs2481037161, rs116768554, rs1369180706, rs2075799, rs2075800, rs199780750, rs9469057, rs2227956, rs771276249, rs199726010, rs35326839, rs775886586, rs2227955, rs34620296, rs2227957 View all (4 more)	RCV003406145 RCV003919204 RCV003931853 RCV003979780 RCV003979820 RCV003912018 RCV003964438 RCV003977361 RCV003899335 RCV003931382 RCV003974775 RCV003962068 RCV003970091 RCV003957886 RCV003970856 RCV003936002 RCV003928533 RCV003936003 RCV003950457
Inflammatory bowel disease 1	Benign; association	rs2227955, rs34620296, rs139868987, rs750447828, rs368138379	RCV001782881 RCV001782882 RCV001782883 RCV001782885 RCV001782884

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Age Related Hearing Impairment 1	Associate	33926545
Bipolar Disorder	Associate	28291257
Carcinoma Non Small Cell Lung	Associate	32971893
Colorectal Neoplasms	Associate	30755640, 33600380
COVID 19	Associate	34823125
Cytomegalovirus Infections	Associate	33446692
Dental Caries	Associate	27567034
Diabetes Mellitus Type 2	Associate	28246355
Diabetic Nephropathies	Associate	28246355
Drug Hypersensitivity	Associate	15024131
Essential Hypertension	Associate	19085089
Glioma	Associate	39454876
Hearing Loss Noise Induced	Associate	17009596, 18813331, 28182740
Idiopathic Pulmonary Fibrosis	Associate	26496868
Inflammatory Bowel Diseases	Associate	28126021
Kidney Diseases	Associate	28246355
Lupus Erythematosus Systemic	Associate	20498198
Macular Degeneration	Associate	30946360
Muscle Hypotonia	Associate	26453269
Nasopharyngeal Carcinoma	Associate	26198046
Neoplasms	Associate	25798051, 32971893
Parkinson Disease	Associate	39454876
Periapical Diseases	Associate	27567034
Periapical Periodontitis	Associate	27567034
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20012387
Prostatitis	Associate	36071874
Pulmonary edema of mountaineers	Associate	16333988
Spinal Cord Injuries	Associate	37063890
Spondylarthropathies	Associate	11779758
Urinary Bladder Neoplasms	Associate	34905506

HSPA1L (heat shock protein family A (Hsp70) member 1 like)