DNAJA1 (DnaJ heat shock protein family (Hsp40) member A1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3301
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJA1
Synonyms (NCBI Gene) Gene synonyms aliases
DJ-2, DjA1, HDJ2, HSDJ, HSJ-2, HSJ2, HSPF4, NEDD7, hDJ-2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the DnaJ family of proteins, which act as heat shock protein 70 cochaperones. Heat shock proteins facilitate protein folding, trafficking, prevention of aggregation, and proteolytic degradation. Members of this family are cha
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(532)
miRTarBase ID miRNA Experiments Reference
MIRT028629 hsa-miR-30a-5p Proteomics 18668040
MIRT032047 hsa-miR-16-5p Proteomics 18668040
MIRT041294 hsa-miR-193b-3p CLASH 23622248
MIRT499620 hsa-miR-6771-3p HITS-CLIP 21572407
MIRT499619 hsa-miR-15a-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(47)
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IPI 12150907
GO:0001671 Function ATPase activator activity IDA 24318877
GO:0001671 Function ATPase activator activity IEA
GO:0005515 Function Protein binding IPI 22085931, 23431407, 25959826, 32814053
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602837 5229 ENSG00000086061
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P31689
Protein name DnaJ homolog subfamily A member 1 (DnaJ protein homolog 2) (HSDJ) (Heat shock 40 kDa protein 4) (Heat shock protein J2) (HSJ-2) (Human DnaJ protein 2) (hDj-2)
Protein function Co-chaperone for HSPA8/Hsc70 (PubMed:10816573). Stimulates ATP hydrolysis, but not the folding of unfolded proteins mediated by HSPA1A (in vitro) (PubMed:24318877). Plays a role in protein transport into mitochondria via its role as co-chaperone
PDB 2LO1 , 2M6Y , 6E8M , 8E2O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 6 → 65 DnaJ domain Domain
PF01556 DnaJ_C 107 → 329 DnaJ C terminal domain Domain
PF00684 DnaJ_CXXCXGXG 134 → 200 DnaJ central domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Isoform 2 is highly expressed in testis and lung, but detected at low levels in thymus, prostate, colon and liver. {ECO:0000269|PubMed:10816573, ECO:0000269|PubMed:15595953}.
Sequence 
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
Sequence length 397
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Protein processing in endoplasmic reticulum   HSP90 chaperone cycle for steroid hormone receptors (SHR)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
Show/Hide Text Mining Associations (21)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23408083
Breast Neoplasms Associate 37977037
Carcinoma Pancreatic Ductal Associate 34264680
Carotid Artery Diseases Stimulate 11331850
Carotid Stenosis Stimulate 11331850
Cerebral Infarction Associate 39735968
Colorectal Neoplasms Associate 34720086
Constriction Pathologic Associate 11331850
Graves Ophthalmopathy Associate 36076300
Hypertension Associate 32664164