Gene Gene information from NCBI Gene database.
Entrez ID 3301
Gene name DnaJ heat shock protein family (Hsp40) member A1
Gene symbol DNAJA1
Synonyms (NCBI Gene)
DJ-2DjA1HDJ2HSDJHSJ-2HSJ2HSPF4NEDD7hDJ-2
Chromosome 9
Chromosome location 9p21.1
Summary This gene encodes a member of the DnaJ family of proteins, which act as heat shock protein 70 cochaperones. Heat shock proteins facilitate protein folding, trafficking, prevention of aggregation, and proteolytic degradation. Members of this family are cha
miRNA miRNA information provided by mirtarbase database.
532
miRTarBase ID miRNA Experiments Reference
MIRT028629 hsa-miR-30a-5p Proteomics 18668040
MIRT032047 hsa-miR-16-5p Proteomics 18668040
MIRT041294 hsa-miR-193b-3p CLASH 23622248
MIRT499620 hsa-miR-6771-3p HITS-CLIP 21572407
MIRT499619 hsa-miR-15a-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IPI 12150907
GO:0001671 Function ATPase activator activity IDA 24318877
GO:0001671 Function ATPase activator activity IEA
GO:0005515 Function Protein binding IPI 22085931, 23431407, 25959826, 32814053
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602837 5229 ENSG00000086061
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31689
Protein name DnaJ homolog subfamily A member 1 (DnaJ protein homolog 2) (HSDJ) (Heat shock 40 kDa protein 4) (Heat shock protein J2) (HSJ-2) (Human DnaJ protein 2) (hDj-2)
Protein function Co-chaperone for HSPA8/Hsc70 (PubMed:10816573). Stimulates ATP hydrolysis, but not the folding of unfolded proteins mediated by HSPA1A (in vitro) (PubMed:24318877). Plays a role in protein transport into mitochondria via its role as co-chaperone
PDB 2LO1 , 2M6Y , 6E8M , 8E2O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 6 65 DnaJ domain Domain
PF01556 DnaJ_C 107 329 DnaJ C terminal domain Domain
PF00684 DnaJ_CXXCXGXG 134 200 DnaJ central domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Isoform 2 is highly expressed in testis and lung, but detected at low levels in thymus, prostate, colon and liver. {ECO:0000269|PubMed:10816573, ECO:0000269|PubMed:15595953}.
Sequence
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYD
KGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVI
CDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRK
IVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFP
ENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
Sequence length 397
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Protein processing in endoplasmic reticulum   HSP90 chaperone cycle for steroid hormone receptors (SHR)