Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3300
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member B2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJB2
Synonyms (NCBI Gene) Gene synonyms aliases
CMT2T, DSMA5, HMNR5, HSJ-1, HSJ1, HSPF3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and pro
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs369661561 A>G Likely-pathogenic Splice acceptor variant
rs562669797 T>A Likely-pathogenic Splice donor variant
rs730882139 G>A Pathogenic, conflicting-interpretations-of-pathogenicity Splice donor variant
rs730882140 A>G Pathogenic, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs756614404 G>A Pathogenic, uncertain-significance Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042091 hsa-miR-484 CLASH 23622248
MIRT614188 hsa-miR-141-5p HITS-CLIP 23824327
MIRT614187 hsa-miR-338-3p HITS-CLIP 23824327
MIRT614186 hsa-miR-6788-3p HITS-CLIP 23824327
MIRT614185 hsa-miR-1238-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 15936278
GO:0001671 Function ATPase activator activity IBA
GO:0001671 Function ATPase activator activity IDA 7957263, 22219199
GO:0005515 Function Protein binding IPI 12754272, 15936278, 21625540, 21719532, 24023695, 25036637, 33961781
GO:0005634 Component Nucleus IDA 12754272
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604139 5228 ENSG00000135924
Protein
UniProt ID P25686
Protein name DnaJ homolog subfamily B member 2 (Heat shock 40 kDa protein 3) (Heat shock protein J1) (HSJ-1)
Protein function Functions as a co-chaperone, regulating the substrate binding and activating the ATPase activity of chaperones of the HSP70/heat shock protein 70 family (PubMed:22219199, PubMed:7957263). In parallel, also contributes to the ubiquitin-dependent
PDB 2LGW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 3 66 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: More abundantly expressed in neocortex, cerebellum, spinal cord and retina where it is expressed by neuronal cells (at protein level) (PubMed:12754272, PubMed:1599432). Detected at much lower level in non-neuronal tissues including kid
Sequence
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYD
RYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLIL
Sequence length 324
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Protein processing in endoplasmic reticulum  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease rs756614404, rs730882139, rs730882140 N/A
Distal Hereditary Motor Neuronopathy Neuronopathy, distal hereditary motor, autosomal recessive 5 rs730882139, rs879253868, rs764813110, rs758322672, rs730882140, rs562669797, rs1182614290, rs1018405924, rs756614404 N/A
Charcot-Marie-Tooth disease Charcot-Marie-Tooth disease axonal type 2T rs797045039 N/A
Charcot-Marie-Tooth Disease, X-Linked Charcot-Marie-Tooth disease X-linked dominant 1 rs756614404 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 28031292
Charcot Marie Tooth Disease Associate 26556829, 26752306, 28031292, 34169998
Charcot Marie Tooth disease X linked recessive 2 Associate 28031292
Distal Hereditary Motor Neuropathy Type II Associate 28031292
Epstein Barr Virus Infections Associate 16448567
Hearing Loss Associate 35286755
Hereditary Sensory and Motor Neuropathy Associate 35286755
Muscular Atrophy Spinal Associate 27449489, 28031292
Muscular Diseases Associate 37070754
Neoplastic Syndromes Hereditary Associate 26752306, 35286755