BIRC3 (baculoviral IAP repeat containing 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
330
Gene name Gene Name - the full gene name approved by the HGNC.
Baculoviral IAP repeat containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BIRC3
Synonyms (NCBI Gene) Gene synonyms aliases
AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits ap
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(34)
miRTarBase ID miRNA Experiments Reference
MIRT000071 hsa-miR-34a-5p Microarray, Northern blot 17540599
MIRT019771 hsa-miR-375 Microarray 20215506
MIRT027437 hsa-miR-98-5p Microarray 19088304
MIRT821549 hsa-miR-1182 CLIP-seq
MIRT821550 hsa-miR-1207-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
Transcription factor Regulation Reference
DEK Unknown 16829531
HDAC1 Activation 17000776
NFKB1 Activation 10733571;11297551;11880364;12010810;19343319
NFKB1 Repression 15231833;15723831;18566231
NFKB1 Unknown 10823821;15050749;17000776;17673602
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(41)
GO ID Ontology Definition Evidence Reference
GO:0002756 Process MyD88-independent toll-like receptor signaling pathway TAS
GO:0004842 Function Ubiquitin-protein transferase activity EXP 10797013
GO:0004842 Function Ubiquitin-protein transferase activity IDA 16395405, 21931591
GO:0004842 Function Ubiquitin-protein transferase activity TAS
GO:0005515 Function Protein binding IPI 11907583, 16123224, 16282325, 16395405, 19690564, 20562859, 21849505, 21931591, 21988832, 22902369, 23524849, 25241761, 25260751
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601721 591 ENSG00000023445
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13489
Protein name Baculoviral IAP repeat-containing protein 3 (EC 2.3.2.27) (Apoptosis inhibitor 2) (API2) (Cellular inhibitor of apoptosis 2) (C-IAP2) (IAP homolog C) (Inhibitor of apoptosis protein 1) (hIAP-1) (hIAP1) (RING finger protein 49) (RING-type E3 ubiquitin tran
Protein function Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin
PDB 2UVL , 3EB5 , 3EB6 , 3M0A , 3M0D , 7NK0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00653 BIR 32 → 97 Inhibitor of Apoptosis domain Domain
PF00653 BIR 172 → 236 Inhibitor of Apoptosis domain Domain
PF00653 BIR 258 → 323 Inhibitor of Apoptosis domain Domain
PF00619 CARD 444 → 528 Caspase recruitment domain Domain
PF13920 zf-C3HC4_3 553 → 598 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in fetal lung, and kidney. In the adult, expression is mainly seen in lymphoid tissues, including spleen, thymus and peripheral blood lymphocytes.
Sequence 
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
Sequence length 604
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Hippo signaling pathway
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Salmonella infection
Toxoplasmosis
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer 		  NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR2 non-canonical NF-kB pathway
Regulation of necroptotic cell death
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ub-specific processing proteases
IKK complex recruitment mediated by RIP1
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Leukemia leukemia rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 12970779
Mucosa-associated lymphoma Mucosa-Associated Lymphoid Tissue Lymphoma rs387906350, rs587776630, rs587776631
Multiple myeloma Multiple Myeloma rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962
View all (38 more)
Show/Hide Text Mining Associations (114)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 12384799
Adenocarcinoma Associate 15138717, 26291056
Adenocarcinoma of Lung Associate 27248820, 36311801, 39364403
Anemia Sickle Cell Associate 17711515
Arthritis Rheumatoid Associate 27534557
Asthma Associate 27420950, 34971648
Asthma Stimulate 35287655
Breast Neoplasms Associate 19563669, 19920189, 21152357, 35859293, 37488535, 37684436
Burkitt Lymphoma Associate 16983704
Buschke Lowenstein Tumor Stimulate 20346172