BIRC3 (baculoviral IAP repeat containing 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 330
Gene name Baculoviral IAP repeat containing 3
Gene symbol BIRC3
Synonyms (NCBI Gene)
AIP1API2CIAP2HAIP1HIAP1IAP-1MALT2MIHCRNF49c-IAP2
Chromosome 11
Chromosome location 11q22.2
Summary This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits ap
miRNA miRNA information provided by mirtarbase database.
34
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (34)
miRTarBase ID miRNA Experiments Reference
MIRT000071 hsa-miR-34a-5p MicroarrayNorthern blot 17540599
MIRT019771 hsa-miR-375 Microarray 20215506
MIRT027437 hsa-miR-98-5p Microarray 19088304
MIRT821549 hsa-miR-1182 CLIP-seq
MIRT821550 hsa-miR-1207-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
9
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
Transcription factor Regulation Reference
DEK Unknown 16829531
HDAC1 Activation 17000776
NFKB1 Activation 10733571;11297551;11880364;12010810;19343319
NFKB1 Repression 15231833;15723831;18566231
NFKB1 Unknown 10823821;15050749;17000776;17673602
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
55
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (55)
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity EXP 10797013
GO:0004842 Function Ubiquitin-protein transferase activity IDA 16395405, 21931591
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0004842 Function Ubiquitin-protein transferase activity TAS
GO:0005515 Function Protein binding IPI 11907583, 16123224, 16282325, 16395405, 19690564, 20562859, 21849505, 21931591, 21988832, 22902369, 23524849, 25241761, 25260751, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601721 591 ENSG00000023445
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13489
Protein name Baculoviral IAP repeat-containing protein 3 (EC 2.3.2.27) (Apoptosis inhibitor 2) (API2) (Cellular inhibitor of apoptosis 2) (C-IAP2) (IAP homolog C) (Inhibitor of apoptosis protein 1) (hIAP-1) (hIAP1) (RING finger protein 49) (RING-type E3 ubiquitin tran
Protein function Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin
PDB 2UVL , 3EB5 , 3EB6 , 3M0A , 3M0D , 7NK0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00653 BIR 32 → 97 Inhibitor of Apoptosis domain Domain
PF00653 BIR 172 → 236 Inhibitor of Apoptosis domain Domain
PF00653 BIR 258 → 323 Inhibitor of Apoptosis domain Domain
PF00619 CARD 444 → 528 Caspase recruitment domain Domain
PF13920 zf-C3HC4_3 553 → 598 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in fetal lung, and kidney. In the adult, expression is mainly seen in lymphoid tissues, including spleen, thymus and peripheral blood lymphocytes.
Sequence 
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
Sequence length 604
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Hippo signaling pathway
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Salmonella infection
Toxoplasmosis
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer 		  NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR2 non-canonical NF-kB pathway
Regulation of necroptotic cell death
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ub-specific processing proteases
IKK complex recruitment mediated by RIP1
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Regional enteritis Likely pathogenic rs2497066643, rs749715948, rs774719063 RCV006264492
RCV006264494
RCV006264495
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs766775968 RCV005939077
Show/Hide Text Mining Associations (114)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 12384799
Adenocarcinoma Associate 15138717, 26291056
Adenocarcinoma of Lung Associate 27248820, 36311801, 39364403
Anemia Sickle Cell Associate 17711515
Arthritis Rheumatoid Associate 27534557
Asthma Associate 27420950, 34971648
Asthma Stimulate 35287655
Breast Neoplasms Associate 19563669, 19920189, 21152357, 35859293, 37488535, 37684436
Burkitt Lymphoma Associate 16983704
Buschke Lowenstein Tumor Stimulate 20346172