Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3297
Gene name	Heat shock transcription factor 1
Gene symbol	HSF1
Synonyms (NCBI Gene)	HSTF1
Chromosome	8
Chromosome location	8q24.3
Summary	The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phosphorylat

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029982	hsa-miR-26b-5p	Microarray	19088304
MIRT439159	hsa-let-7c-5p	3'LIFE	25074381
MIRT439159	hsa-let-7c-5p	3'LIFE	25074381
MIRT1055712	hsa-miR-1197	CLIP-seq
MIRT1055713	hsa-miR-1275	CLIP-seq
MIRT1055714	hsa-miR-1292	CLIP-seq
MIRT1055715	hsa-miR-3675-3p	CLIP-seq
MIRT1055716	hsa-miR-3714	CLIP-seq
MIRT1055717	hsa-miR-4271	CLIP-seq
MIRT1055718	hsa-miR-4462	CLIP-seq
MIRT1055719	hsa-miR-4525	CLIP-seq
MIRT1055720	hsa-miR-4665-5p	CLIP-seq
MIRT1055721	hsa-miR-4706	CLIP-seq
MIRT1055722	hsa-miR-4723-5p	CLIP-seq
MIRT1055723	hsa-miR-4725-3p	CLIP-seq
MIRT1055724	hsa-miR-4747-5p	CLIP-seq
MIRT1055725	hsa-miR-4749-5p	CLIP-seq
MIRT1055726	hsa-miR-4781-5p	CLIP-seq
MIRT1055727	hsa-miR-548c-3p	CLIP-seq
MIRT1055728	hsa-miR-602	CLIP-seq
MIRT1055729	hsa-miR-625	CLIP-seq
MIRT1055715	hsa-miR-3675-3p	CLIP-seq
MIRT2012787	hsa-miR-4257	CLIP-seq
MIRT2012788	hsa-miR-4667-3p	CLIP-seq
MIRT2012789	hsa-miR-4725-5p	CLIP-seq
MIRT2012790	hsa-miR-504	CLIP-seq
MIRT2245106	hsa-miR-1910	CLIP-seq
MIRT2245107	hsa-miR-3173-5p	CLIP-seq
MIRT2245108	hsa-miR-3611	CLIP-seq
MIRT2245109	hsa-miR-3934	CLIP-seq
MIRT2245110	hsa-miR-4323	CLIP-seq
MIRT2245111	hsa-miR-4474-3p	CLIP-seq
MIRT2245112	hsa-miR-455-3p	CLIP-seq
MIRT2245113	hsa-miR-4687-3p	CLIP-seq
MIRT2245114	hsa-miR-4786-3p	CLIP-seq
MIRT2245115	hsa-miR-644	CLIP-seq
MIRT2245116	hsa-miR-652	CLIP-seq
MIRT2389200	hsa-miR-431	CLIP-seq
MIRT2389201	hsa-miR-4421	CLIP-seq
MIRT2451425	hsa-miR-146b-3p	CLIP-seq
MIRT2245107	hsa-miR-3173-5p	CLIP-seq
MIRT2451426	hsa-miR-485-5p	CLIP-seq
MIRT2451427	hsa-miR-874	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CEBPB	Unknown	11801594
NCOA6	Activation	14960326
SIRT1	Activation	23349863
SIRT1	Unknown	19229036
TP53	Unknown	20180806

127

Show/Hide all (127)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	8926278, 9341107
GO:0000165	Process	MAPK cascade	IDA	12917326
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	18794143
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	24504023
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	8926278, 8972228
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	24504023
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001162	Function	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	10561509
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	8926278
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	7760831, 25963659
GO:0001701	Process	In utero embryonic development	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	IDA	7935471, 8455624, 9222587, 9341107, 9499401, 9727490, 10359787, 10413683, 10747973, 11514557, 11583998, 12659875, 12665592, 12917326, 16278218, 16554823, 26754925
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1871105, 10821850
GO:0005515	Function	Protein binding	IPI	9222587, 9499401, 10747973, 11583998, 12917326, 14707147, 15016915, 16278218, 17897941, 18451878, 18794143, 19684601, 21085490, 21597468, 23352416, 25036637, 25816751, 26159920, 26359349, 26496226, 26517842, 26727490, 26754925, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	8455624, 9341107, 10413683, 10747973, 12665592, 12917326, 14707147, 21085490, 25963659, 26159920
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	26359349
GO:0005654	Component	Nucleoplasm	IDA	10359787
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	8455624, 10413683, 10747973, 12917326, 21085490, 26159920
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	18794143
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	7760831
GO:0006397	Process	MRNA processing	IEA
GO:0006952	Process	Defense response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0009408	Process	Response to heat	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016605	Component	PML body	IDA	11514557
GO:0019901	Function	Protein kinase binding	IPI	16278218
GO:0031072	Function	Heat shock protein binding	IDA	9727490, 11583998, 16278218
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	26359349
GO:0031490	Function	Chromatin DNA binding	IDA	21085490
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0034605	Process	Cellular response to heat	IDA	7760831, 7935471, 9222587, 9341107, 9499401, 10359787, 10413683, 10747973, 11514557, 11583998, 12659875, 12665592, 12917326, 14707147, 16554823, 17897941, 21085490, 26159920
GO:0034605	Process	Cellular response to heat	IEA
GO:0034605	Process	Cellular response to heat	IMP	8455624, 9727490
GO:0034620	Process	Cellular response to unfolded protein	IDA	15016915
GO:0035865	Process	Cellular response to potassium ion	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IDA	7935471, 9222587, 9727490, 11583998, 16554823, 26754925
GO:0042802	Function	Identical protein binding	IPI	26727490, 29997244
GO:0043200	Process	Response to amino acid	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	25963659
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045120	Component	Pronucleus	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	24504023
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	18794143
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10561509
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9341107, 9499401, 10747973, 11514557, 12659875, 12665592, 12917326, 15016915, 16278218, 21085490, 21597468, 24504023, 25963659, 26754925
GO:0046982	Function	Protein heterodimerization activity	IDA	9222587
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21085490
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051879	Function	Hsp90 protein binding	IDA	11583998
GO:0060136	Process	Embryonic process involved in female pregnancy	IEA
GO:0061770	Function	Translation elongation factor binding	IDA	16554823
GO:0062029	Process	Positive regulation of stress granule assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	11583998
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071276	Process	Cellular response to cadmium ion	IDA	10359787, 11514557, 15016915
GO:0071280	Process	Cellular response to copper ion	IDA	15016915
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071478	Process	Cellular response to radiation	IEA
GO:0071480	Process	Cellular response to gamma radiation	IDA	26359349
GO:0072738	Process	Cellular response to diamide	IDA	15016915
GO:0090084	Process	Negative regulation of inclusion body assembly	IEA
GO:0090261	Process	Positive regulation of inclusion body assembly	IEA
GO:0097165	Component	Nuclear stress granule	IDA	10359787, 10747973, 11514557, 12665592, 14707147, 25963659
GO:0097431	Component	Mitotic spindle pole	IDA	18794143
GO:0097677	Function	STAT family protein binding	IEA
GO:0098847	Function	Sequence-specific single stranded DNA binding	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	8455624
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26344102
GO:0140296	Function	General transcription initiation factor binding	IPI	11005381
GO:1900034	Process	Regulation of cellular response to heat	IDA	11583998
GO:1901652	Process	Response to peptide	IEA
GO:1902512	Process	Positive regulation of apoptotic DNA fragmentation	IEA
GO:1903936	Process	Cellular response to sodium arsenite	IDA	15016915
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904843	Process	Cellular response to nitroglycerin	IEA
GO:1904845	Process	Cellular response to L-glutamine	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	16554823
GO:1990910	Process	Response to hypobaric hypoxia	IEA
GO:1990911	Process	Response to psychosocial stress	IEA
GO:2001033	Process	Negative regulation of double-strand break repair via nonhomologous end joining	IMP	26359349
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
140580	5224	ENSG00000185122

Q00613

Protein name

Heat shock factor protein 1 (HSF 1) (Heat shock transcription factor 1) (HSTF 1)

Protein function

Functions as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones, heat shock pro

PDB

2LDU , 5D5U , 5D5V , 5HDG , 5HDN , 7DCJ , 7DCS , 7DCT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00447	HSF_DNA-bind	18 → 118	HSF-type DNA-binding	Domain
PF06546	Vert_HS_TF	247 → 529	Vertebrate heat shock transcription factor	Family

Sequence

MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Sequence length

529

Interactions

View interactions

	KEGG		Reactome
	Legionellosis		Regulation of HSF1-mediated heat shock response HSF1 activation Attenuation phase HSF1-dependent transactivation

HSF1 (heat shock transcription factor 1)