HSD17B1 (hydroxysteroid 17-beta dehydrogenase 1)

Gene

• Entrez ID: 3292
• Gene name: Hydroxysteroid 17-beta dehydrogenase 1
• Gene symbol: HSD17B1
• Synonyms (NCBI Gene): 17-beta-HSD, 20-alpha-HSD, E2DH, EDH17B2, EDHB17, HSD17, SDR28C1
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053179	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR	22203747
MIRT053180	hsa-miR-518c-3p	Luciferase reporter assay, qRT-PCR	22203747
MIRT2245031	hsa-miR-1208	CLIP-seq
MIRT2245032	hsa-miR-149	CLIP-seq
MIRT2245033	hsa-miR-3064-5p	CLIP-seq
MIRT2245034	hsa-miR-3194-3p	CLIP-seq
MIRT2245035	hsa-miR-3652	CLIP-seq
MIRT2245036	hsa-miR-4430	CLIP-seq
MIRT2245037	hsa-miR-4505	CLIP-seq
MIRT2245038	hsa-miR-4794	CLIP-seq
MIRT2245039	hsa-miR-892a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Repression	9231796
SP1	Activation	9231796
TFAP2A	Repression	9231796
TFAP2A	Unknown	10419022

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	TAS	8547176
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IBA
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IDA	4396689, 8994190, 9525918, 10625652
GO:0004303	Function	Estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA
GO:0005496	Function	Steroid binding	IDA	4396689
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8547176
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006694	Process	Steroid biosynthetic process	IEA
GO:0006694	Process	Steroid biosynthetic process	TAS	8547176
GO:0006703	Process	Estrogen biosynthetic process	IBA
GO:0006703	Process	Estrogen biosynthetic process	IDA	8994190
GO:0006703	Process	Estrogen biosynthetic process	IEA
GO:0006703	Process	Estrogen biosynthetic process	ISS
GO:0007040	Process	Lysosome organization	IEA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0008210	Process	Estrogen metabolic process	TAS	2584224
GO:0010467	Process	Gene expression	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0036094	Function	Small molecule binding	EXP	9525918
GO:0042803	Function	Protein homodimerization activity	IDA	8994190
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0047045	Function	Testosterone dehydrogenase (NADP+) activity	IEA
GO:0050661	Function	NADP binding	IDA	8805577
GO:0060348	Process	Bone development	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061370	Process	Testosterone biosynthetic process	IEA
GO:0061370	Process	Testosterone biosynthetic process	ISS
GO:0070401	Function	NADP+ binding	IMP	9525918
GO:0071248	Process	Cellular response to metal ion	IEA
GO:0072582	Function	17-beta-hydroxysteroid dehydrogenase (NADP+) activity	IEA
GO:0072582	Function	17-beta-hydroxysteroid dehydrogenase (NADP+) activity	ISS
GO:1903924	Function	Estradiol binding	IDA	10625652

Other IDs

• MIM: 109684
• HGNC: 5210
• e!Ensembl: ENSG00000108786

Protein

• UniProt ID: P14061
• Protein name: 17-beta-hydroxysteroid dehydrogenase type 1 (17-beta-HSD 1) (EC 1.1.1.51) (20 alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (E2DH) (Estradiol 17-beta-dehydrogenase 1) (EC 1.1.1.62) (Placental 17-beta-hydroxysteroid dehydrogenase) (Short chain dehydro
• Protein function: Favors the reduction of estrogens and androgens. Converts estrone (E1) to a more potent estrogen, 17beta-estradiol (E2) (PubMed:8994190). Also has 20-alpha-HSD activity. Uses preferentially NADH.
• PDB: 1A27, 1BHS, 1DHT, 1EQU, 1FDS, 1FDT, 1FDU, 1FDV, 1FDW, 1I5R, 1IOL, 1JTV, 1QYV, 1QYW, 1QYX, 3DEY, 3DHE, 3HB4, 3HB5, 3KLM, 3KLP, 3KM0, 6CGC, 6CGE, 6DTP, 6MNC, 6MNE, 7X3Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00106	adh_short	4 → 201	short chain dehydrogenase	Domain

• Sequence:

  MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
  ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
  RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
  LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
  FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
  GAGPGAEDEAGRGAVGDPELGDPPAAPQ

• Sequence length: 328

Pathways

KEGG:

Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis

Reactome:

Estrogen biosynthesis