BIRC2 (baculoviral IAP repeat containing 2)

Gene

• Entrez ID: 329
• Gene name: Baculoviral IAP repeat containing 2
• Gene symbol: BIRC2
• Synonyms (NCBI Gene): API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1
• Chromosome: 11
• Chromosome location: 11q22.2
• Summary: The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded prote

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005820	hsa-miR-204-5p	Immunoblot, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21282569
MIRT022141	hsa-miR-124-3p	Microarray	18668037
MIRT755994	hsa-miR-634	Luciferase reporter assay, Western blotting	35571376
MIRT821534	hsa-miR-1297	CLIP-seq
MIRT821535	hsa-miR-135a	CLIP-seq
MIRT821536	hsa-miR-135b	CLIP-seq
MIRT821537	hsa-miR-26a	CLIP-seq
MIRT821538	hsa-miR-26b	CLIP-seq
MIRT821539	hsa-miR-3065-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT821541	hsa-miR-338-5p	CLIP-seq
MIRT821542	hsa-miR-421	CLIP-seq
MIRT821543	hsa-miR-4255	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT821545	hsa-miR-4465	CLIP-seq
MIRT821546	hsa-miR-4519	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT821548	hsa-miR-4760-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT821539	hsa-miR-3065-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2181626	hsa-miR-767-5p	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485178	hsa-miR-197	CLIP-seq
MIRT2485179	hsa-miR-204	CLIP-seq
MIRT2485180	hsa-miR-211	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT2485181	hsa-miR-330-3p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT2485182	hsa-miR-3942-3p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT2485183	hsa-miR-4755-5p	CLIP-seq
MIRT2485184	hsa-miR-4771	CLIP-seq
MIRT2485185	hsa-miR-4780	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485186	hsa-miR-4803	CLIP-seq
MIRT2485187	hsa-miR-623	CLIP-seq
MIRT2485178	hsa-miR-197	CLIP-seq
MIRT2485179	hsa-miR-204	CLIP-seq
MIRT2485180	hsa-miR-211	CLIP-seq
MIRT821540	hsa-miR-3117-5p	CLIP-seq
MIRT1942867	hsa-miR-331-5p	CLIP-seq
MIRT2485182	hsa-miR-3942-3p	CLIP-seq
MIRT821544	hsa-miR-4287	CLIP-seq
MIRT1942868	hsa-miR-4643	CLIP-seq
MIRT1942869	hsa-miR-466	CLIP-seq
MIRT821547	hsa-miR-4685-3p	CLIP-seq
MIRT2485183	hsa-miR-4755-5p	CLIP-seq
MIRT2485185	hsa-miR-4780	CLIP-seq
MIRT1942870	hsa-miR-4789-3p	CLIP-seq
MIRT2485186	hsa-miR-4803	CLIP-seq
MIRT2485187	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	12010810;15756023
NFKB1	Repression	18566231
NFKB1	Unknown	12687011;15050749;16453001;17673602;20103608
RELA	Activation	12010810;15756023
RELA	Repression	18566231
RELA	Unknown	12687011;15050749;16453001;17673602;20103608

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	11907583
GO:0001666	Process	Response to hypoxia	IEA
GO:0001741	Component	XY body	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	21653699
GO:0004842	Function	Ubiquitin-protein transferase activity	EXP	10797013
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	11907583, 21931591
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	11084335, 11583623, 11907583, 15665297, 16189514, 16282325, 18846110, 19153467, 20447407, 20562859, 21516116, 21525013, 21653699, 21849505, 21931591, 21988832, 22117219, 23524849, 25241761, 25416956, 25486457, 25910212, 28514442, 30561431, 31515488, 31617661, 32296183, 32814053, 339
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15665297, 16510124, 18239673
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16510124, 18239673
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8548810
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	TAS
GO:0008270	Function	Zinc ion binding	IDA	19153467, 20447407
GO:0008270	Function	Zinc ion binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0016740	Function	Transferase activity	EXP	19008929
GO:0016740	Function	Transferase activity	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IEA
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	TAS	20888210
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	TAS	20651737
GO:0039535	Process	Regulation of RIG-I signaling pathway	IEA
GO:0039535	Process	Regulation of RIG-I signaling pathway	TAS	20888210
GO:0042127	Process	Regulation of cell population proliferation	TAS	18414036
GO:0042802	Function	Identical protein binding	IPI	22493164, 25383668, 30561431, 31515488
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IMP	21737330
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21525013
GO:0043066	Process	Negative regulation of apoptotic process	TAS	20651737
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043130	Function	Ubiquitin binding	IDA	16510124
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11907583
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045088	Process	Regulation of innate immune response	TAS	21447281
GO:0045471	Process	Response to ethanol	IEA
GO:0045595	Process	Regulation of cell differentiation	TAS	18414036
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	TAS	21447281
GO:0051087	Function	Protein-folding chaperone binding	IPI	18239673
GO:0051591	Process	Response to cAMP	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IDA	15665297
GO:0060544	Process	Regulation of necroptotic process	IEA
GO:0060544	Process	Regulation of necroptotic process	IMP	21737330
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0060546	Process	Negative regulation of necroptotic process	IBA
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070266	Process	Necroptotic process	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	IEA
GO:0070424	Process	Regulation of nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS	20888210
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0098770	Function	FBXO family protein binding	IPI	16510124
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1902443	Process	Negative regulation of ripoptosome assembly involved in necroptotic process	IEA
GO:1902523	Process	Positive regulation of protein K63-linked ubiquitination	IDA	21931591
GO:1902524	Process	Positive regulation of protein K48-linked ubiquitination	IDA	21931591
GO:1902527	Process	Positive regulation of protein monoubiquitination	IDA	21931591
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:1904975	Process	Response to bleomycin	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 601712
• HGNC: 590
• e!Ensembl: ENSG00000110330

Protein

• UniProt ID: Q13490
• Protein name: Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (IAP homolog B) (Inhibitor of apoptosis protein 2) (hIAP-2) (hIAP2) (RING finger protein 48) (RING-type E3 ubiquitin transferase BIRC2) (TNFR2-TRAF-sign
• Protein function: Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquiti
• PDB: 1QBH, 2L9M, 3D9T, 3D9U, 3M1D, 3MUP, 3OZ1, 3T6P, 3UW4, 4EB9, 4HY4, 4HY5, 4KMN, 4LGE, 4LGU, 4MTI, 4MU7, 5M6N, 6EXW, 6HPR, 6W74, 6W7O, 6W8I, 7QGJ, 7TRL, 7TRM, 8DSF, 8DSO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00653	BIR	49 → 114	Inhibitor of Apoptosis domain	Domain
  PF00653	BIR	187 → 251	Inhibitor of Apoptosis domain	Domain
  PF00653	BIR	272 → 337	Inhibitor of Apoptosis domain	Domain
  PF00619	CARD	458 → 542	Caspase recruitment domain	Domain
  PF13920	zf-C3HC4_3	567 → 612		Domain

• Tissue specificity: TISSUE SPECIFICITY: Present in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.
• Sequence:

  MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
  PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
  LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
  MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
  RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
  NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
  STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
  GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
  NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
  VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
  KCPICRGIIKGTVRTFLS

• Sequence length: 618

Pathways

KEGG:

Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Hippo signaling pathway
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Salmonella infection
Toxoplasmosis
Herpes simplex virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer

Reactome:

Apoptotic cleavage of cellular proteins
NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR2 non-canonical NF-kB pathway
Regulation of necroptotic cell death
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Ub-specific processing proteases
IKK complex recruitment mediated by RIP1

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Acute myeloid leukemia	Benign	rs34510872	RCV005921648
Adrenocortical carcinoma, hereditary	Benign	rs34510872	RCV005921652
BIRC2-related disorder	Likely benign	rs61754131	RCV003942074
Cervical cancer	Benign	rs34510872	RCV005921653
Hepatocellular carcinoma	Benign	rs34510872	RCV005921649
Malignant lymphoma, large B-cell, diffuse	Benign	rs34510872	RCV005921654
Malignant tumor of esophagus	Benign	rs34510872	RCV005921650
Nonpapillary renal cell carcinoma	Benign	rs34510872	RCV005921651
Thalidomide response	Benign	rs34510872	RCV005414337
Thymoma	Benign	rs34510872	RCV005921656
Uterine carcinosarcoma	Benign	rs34510872	RCV005921655

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	39396083
Anemia Sickle Cell	Associate	17711515
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	36389787
Arthritis Rheumatoid	Associate	27534557, 37904685
Ataxia Telangiectasia	Associate	11382748
Breast Neoplasms	Associate	19563669, 24359639, 25033461, 31217499
Burkitt Lymphoma	Associate	16983704
Buschke Lowenstein Tumor	Stimulate	20346172
Cap Myopathy	Associate	26799286
Carcinogenesis	Associate	12384799
Carcinogenesis	Stimulate	18082613
Carcinoma Hepatocellular	Associate	18230607, 20825417, 20951133
Carcinoma Non Small Cell Lung	Associate	11484955, 31378747
Carcinoma Pancreatic Ductal	Associate	16775116
Carcinoma Pancreatic Ductal	Stimulate	30670910
Colorectal Neoplasms	Associate	27827395
Depressive Disorder Major	Associate	37098514
Digestive System Diseases	Associate	20951133
Drug Related Side Effects and Adverse Reactions	Associate	10984607, 27617834
Esophageal Squamous Cell Carcinoma	Associate	18230607, 20825417
Familial Mediterranean Fever	Associate	37140617
Fanconi Anemia	Associate	34997070
Gingival Diseases	Associate	31743516
Glioma	Associate	31957840
Glomerulonephritis Membranous	Associate	24345872
Granulosa Cell Tumor	Associate	31412918
HAIR AN syndrome	Associate	23967300
Head and Neck Neoplasms	Associate	30421089, 34997070
HIV Infections	Associate	30344003, 30653393, 32719312, 34824340
Hypereosinophilic Syndrome	Associate	16761316
Inflammation	Associate	15365572, 33493135, 37140617, 37289679
Inflammation	Stimulate	37904685
Inflammatory Bowel Diseases	Associate	28422189
Leukemia	Associate	11071269
Leukemia B Cell	Associate	16983704
Leukemia Lymphocytic Chronic B Cell	Associate	12411322, 12586635
Leukemia Myeloid Acute	Associate	24526787, 30970518, 31831875
Leukemia Prolymphocytic T Cell	Associate	16156855
Lung Neoplasms	Associate	18230607, 20825417, 24261825
Lymphatic Metastasis	Associate	29167558
Lymphoma	Associate	16156855, 16983704
Lymphoma B Cell Marginal Zone	Associate	16983704
Lymphoma Large B Cell Diffuse	Associate	16983704
Lymphoma Large Cell Anaplastic	Associate	15050749
Lymphoma Non Hodgkin	Associate	16156855, 16983704
Lymphomatoid Papulosis	Stimulate	20346172
Medulloblastoma	Associate	27537345, 29984917
Melanoma	Associate	33399091, 34638912
Multiple Myeloma	Associate	17692804, 17692805, 24987674
Neoplasm Residual	Associate	37343247
Neoplasms	Associate	11484955, 15138717, 15142883, 16504151, 16775116, 18230607, 20098684, 20346172, 20547836, 20825417, 20862547, 20951133, 22847005, 25100434, 25669656, 26168135, 27537345, 29167558, 29885057, 29984917, 30055105, 30258062, 30421089, 34997070, 35613525, 35926468, 35985688, 36308574, 38484558, 39327470
Neoplasms	Stimulate	18082613
Neoplasms	Inhibit	34638912
Nevus Pigmented	Associate	12535197
Ovarian Neoplasms	Associate	26168135
Pancreatic Neoplasms	Associate	16036106, 30670910, 32186702
Pancreatitis Chronic	Associate	16127431
Parkinson Disease	Associate	25635055
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25079338
Prostatic Hyperplasia	Associate	20078866
Prostatic Neoplasms	Associate	19549337
Prostatitis	Associate	20078866
Squamous Cell Carcinoma of Head and Neck	Associate	30421089, 34997070, 35985688
Stomach Neoplasms	Associate	25635055, 26811494
Triple Negative Breast Neoplasms	Associate	26733177, 27272773
Urinary Bladder Neoplasms	Associate	33452764
Uterine Cervical Dysplasia	Associate	16775116
Uterine Cervical Neoplasms	Inhibit	16504151
Uterine Cervical Neoplasms	Associate	18230607, 20825417, 38307027
Waldenstrom Macroglobulinemia	Associate	16983704