Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3280
Gene name	Hes family bHLH transcription factor 1
Gene symbol	HES1
Synonyms (NCBI Gene)	HES-1HHLHRYbHLHb39
Chromosome	3
Chromosome location	3q29
Summary	This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix int

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002953	hsa-miR-23a-3p	Luciferase reporter assay	15066185
MIRT002953	hsa-miR-23a-3p	ImmunofluorescenceLuciferase reporter assayNorthern blotWestern blot	12808467
MIRT000208	hsa-miR-199b-5p	FlowImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	19308264
MIRT006893	hsa-miR-524-5p	SNB19	22871495
MIRT006893	hsa-miR-524-5p	SNB19	22871495
MIRT000208	hsa-miR-199b-5p	Luciferase reporter assay	23354452
MIRT051991	hsa-let-7b-5p	CLASH	23622248
MIRT049494	hsa-miR-92a-3p	CLASH	23622248
MIRT046625	hsa-miR-222-3p	CLASH	23622248
MIRT038426	hsa-miR-296-3p	CLASH	23622248
MIRT006893	hsa-miR-524-5p	qRT-PCR	25172935
MIRT736863	hsa-miR-9-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	27426040
MIRT733902	hsa-miR-145-3p	Luciferase reporter assayqRT-PCRWestern blotting	32588730
MIRT736863	hsa-miR-9-3p	Western blottingMicroarrayqRT-PCRFlow cytometry	34055767
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT1044508	hsa-miR-1271	CLIP-seq
MIRT1044509	hsa-miR-1297	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT1044511	hsa-miR-1305	CLIP-seq
MIRT1044512	hsa-miR-150	CLIP-seq
MIRT1044513	hsa-miR-182	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT1044515	hsa-miR-26a	CLIP-seq
MIRT1044516	hsa-miR-26b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044518	hsa-miR-3163	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT1044521	hsa-miR-323b-3p	CLIP-seq
MIRT1044522	hsa-miR-3658	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044527	hsa-miR-3909	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT1044530	hsa-miR-4272	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044532	hsa-miR-4465	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT1044536	hsa-miR-4642	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT1044538	hsa-miR-4713-5p	CLIP-seq
MIRT1044539	hsa-miR-4768-5p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT1044544	hsa-miR-532-3p	CLIP-seq
MIRT1044545	hsa-miR-607	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044548	hsa-miR-9	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044550	hsa-miR-942	CLIP-seq
MIRT1044551	hsa-miR-96	CLIP-seq
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT2009707	hsa-miR-1283	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT2009708	hsa-miR-130a	CLIP-seq
MIRT2009709	hsa-miR-130b	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT2009710	hsa-miR-301a	CLIP-seq
MIRT2009711	hsa-miR-301b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT2009712	hsa-miR-3666	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT2009713	hsa-miR-4295	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT2009714	hsa-miR-454	CLIP-seq
MIRT2009715	hsa-miR-4671-3p	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT2009716	hsa-miR-4704-3p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT2009717	hsa-miR-548ad	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT1044509	hsa-miR-1297	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT1044511	hsa-miR-1305	CLIP-seq
MIRT1044512	hsa-miR-150	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT1044515	hsa-miR-26a	CLIP-seq
MIRT1044516	hsa-miR-26b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT1044521	hsa-miR-323b-3p	CLIP-seq
MIRT2242027	hsa-miR-3613-3p	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044527	hsa-miR-3909	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT1044530	hsa-miR-4272	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044532	hsa-miR-4465	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT1044538	hsa-miR-4713-5p	CLIP-seq
MIRT1044539	hsa-miR-4768-5p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT1044544	hsa-miR-532-3p	CLIP-seq
MIRT2009717	hsa-miR-548ad	CLIP-seq
MIRT1044545	hsa-miR-607	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044548	hsa-miR-9	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044550	hsa-miR-942	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
LMO3	Repression	21573214
NFKB1	Unknown	17876798
NHLH2	Repression	21573214
NOTCH3	Repression	22117196
PITX1	Repression	21425961
RELA	Unknown	17876798
RUNX3	Repression	19800882
SNW1	Unknown	15546612
SOX9	Activation	19322650

186

Show/Hide all (186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12032823, 12535671
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001217	Function	DNA-binding transcription repressor activity	IEA
GO:0001222	Function	Transcription corepressor binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001701	Process	In utero embryonic development	IEA
GO:0001709	Process	Cell fate determination	IEA
GO:0001889	Process	Liver development	IEA
GO:0002085	Process	Inhibition of neuroepithelial cell differentiation	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003266	Process	Regulation of secondary heart field cardioblast proliferation	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003281	Process	Ventricular septum development	ISS
GO:0003310	Process	Pancreatic A cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	7906273
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	12535671
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007219	Process	Notch signaling pathway	IBA
GO:0007219	Process	Notch signaling pathway	IDA	16160079
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IMP	19682396
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007399	Process	Nervous system development	TAS	8020957
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008432	Function	JUN kinase binding	IEA
GO:0009615	Process	Response to virus	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016477	Process	Cell migration	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0021555	Process	Midbrain-hindbrain boundary morphogenesis	IEA
GO:0021557	Process	Oculomotor nerve development	IEA
GO:0021558	Process	Trochlear nerve development	IEA
GO:0021575	Process	Hindbrain morphogenesis	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	ISS
GO:0021870	Process	Cajal-Retzius cell differentiation	IEA
GO:0021915	Process	Neural tube development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021983	Process	Pituitary gland development	IEA
GO:0021984	Process	Adenohypophysis development	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035315	Process	Hair cell differentiation	IEA
GO:0035881	Process	Amacrine cell differentiation	IEA
GO:0035909	Process	Aorta morphogenesis	IEA
GO:0035910	Process	Ascending aorta morphogenesis	IEA
GO:0035910	Process	Ascending aorta morphogenesis	ISS
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042491	Process	Inner ear auditory receptor cell differentiation	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	12535671
GO:0043254	Process	Regulation of protein-containing complex assembly	IEA
GO:0043279	Process	Response to alkaloid	IEA
GO:0043388	Process	Positive regulation of DNA binding	ISS
GO:0043398	Function	HLH domain binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045608	Process	Negative regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IBA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045687	Process	Positive regulation of glial cell differentiation	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12535671
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045977	Process	Positive regulation of mitotic cell cycle, embryonic	IEA
GO:0045977	Process	Positive regulation of mitotic cell cycle, embryonic	ISS
GO:0046331	Process	Lateral inhibition	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048505	Process	Regulation of timing of cell differentiation	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0060122	Process	Inner ear receptor cell stereocilium organization	IEA
GO:0060164	Process	Regulation of timing of neuron differentiation	IEA
GO:0060253	Process	Negative regulation of glial cell proliferation	IEA
GO:0060253	Process	Negative regulation of glial cell proliferation	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060675	Process	Ureteric bud morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061009	Process	Common bile duct development	IEA
GO:0061101	Process	Neuroendocrine cell differentiation	IEA
GO:0061102	Process	Stomach neuroendocrine cell differentiation	IEA
GO:0061106	Process	Negative regulation of stomach neuroendocrine cell differentiation	IEA
GO:0061309	Process	Cardiac neural crest cell development involved in outflow tract morphogenesis	IEA
GO:0061626	Process	Pharyngeal arch artery morphogenesis	IEA
GO:0061626	Process	Pharyngeal arch artery morphogenesis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0070888	Function	E-box binding	IBA
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071820	Function	N-box binding	IBA
GO:0071820	Function	N-box binding	IEA
GO:0071820	Function	N-box binding	ISS
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072049	Process	Comma-shaped body morphogenesis	IEA
GO:0072050	Process	S-shaped body morphogenesis	IEA
GO:0072141	Process	Renal interstitial fibroblast development	IEA
GO:0072282	Process	Metanephric nephron tubule morphogenesis	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	IEA
GO:0090281	Process	Negative regulation of calcium ion import	IEA
GO:0097066	Process	Response to thyroid hormone	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	ISS
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	IEP	19682396
GO:1902870	Process	Negative regulation of amacrine cell differentiation	IEA
GO:1904010	Process	Response to Aroclor 1254	IEA
GO:1905934	Process	Negative regulation of cell fate determination	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000227	Process	Negative regulation of pancreatic A cell differentiation	IEA
GO:2000737	Process	Negative regulation of stem cell differentiation	IMP	19682396
GO:2000974	Process	Negative regulation of pro-B cell differentiation	IMP	12032823
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	IEA
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	IEA
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	ISS
GO:2000981	Process	Negative regulation of inner ear receptor cell differentiation	IEA

MIM	HGNC	e!Ensembl
139605	5192	ENSG00000114315

Q14469

Protein name

Transcription factor HES-1 (Class B basic helix-loop-helix protein 39) (bHLHb39) (Hairy and enhancer of split 1) (Hairy homolog) (Hairy-like protein) (hHL)

Protein function

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and o

PDB

2MH3 , 7C4O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	35 → 92	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	109 → 148	Hairy Orange	Domain

Sequence

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Sequence length

280

Interactions

View interactions

	KEGG		Reactome
	Fanconi anemia pathway Notch signaling pathway Maturity onset diabetes of the young Human papillomavirus infection Epstein-Barr virus infection Pathways in cancer Breast cancer		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants RUNX3 regulates NOTCH signaling NOTCH4 Intracellular Domain Regulates Transcription

HES1 (hes family bHLH transcription factor 1)