Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3280
Gene name Gene Name - the full gene name approved by the HGNC.	Hes family bHLH transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HES1
Synonyms (NCBI Gene) Gene synonyms aliases	HES-1, HHL, HRY, bHLHb39
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q29
Summary Summary of gene provided in NCBI Entrez Gene.	This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix int

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002953	hsa-miR-23a-3p	Luciferase reporter assay	15066185
MIRT002953	hsa-miR-23a-3p	Immunofluorescence, Luciferase reporter assay, Northern blot, Western blot	12808467
MIRT000208	hsa-miR-199b-5p	Flow, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	19308264
MIRT006893	hsa-miR-524-5p	SNB19	22871495
MIRT006893	hsa-miR-524-5p	SNB19	22871495
MIRT000208	hsa-miR-199b-5p	Luciferase reporter assay	23354452
MIRT051991	hsa-let-7b-5p	CLASH	23622248
MIRT049494	hsa-miR-92a-3p	CLASH	23622248
MIRT046625	hsa-miR-222-3p	CLASH	23622248
MIRT038426	hsa-miR-296-3p	CLASH	23622248
MIRT006893	hsa-miR-524-5p	qRT-PCR	25172935
MIRT736863	hsa-miR-9-3p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	27426040
MIRT733902	hsa-miR-145-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32588730
MIRT736863	hsa-miR-9-3p	Western blotting, Microarray, qRT-PCR, Flow cytometry	34055767
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT1044508	hsa-miR-1271	CLIP-seq
MIRT1044509	hsa-miR-1297	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT1044511	hsa-miR-1305	CLIP-seq
MIRT1044512	hsa-miR-150	CLIP-seq
MIRT1044513	hsa-miR-182	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT1044515	hsa-miR-26a	CLIP-seq
MIRT1044516	hsa-miR-26b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044518	hsa-miR-3163	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT1044521	hsa-miR-323b-3p	CLIP-seq
MIRT1044522	hsa-miR-3658	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044527	hsa-miR-3909	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT1044530	hsa-miR-4272	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044532	hsa-miR-4465	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT1044536	hsa-miR-4642	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT1044538	hsa-miR-4713-5p	CLIP-seq
MIRT1044539	hsa-miR-4768-5p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT1044544	hsa-miR-532-3p	CLIP-seq
MIRT1044545	hsa-miR-607	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044548	hsa-miR-9	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044550	hsa-miR-942	CLIP-seq
MIRT1044551	hsa-miR-96	CLIP-seq
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT2009707	hsa-miR-1283	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT2009708	hsa-miR-130a	CLIP-seq
MIRT2009709	hsa-miR-130b	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT2009710	hsa-miR-301a	CLIP-seq
MIRT2009711	hsa-miR-301b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT2009712	hsa-miR-3666	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT2009713	hsa-miR-4295	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT2009714	hsa-miR-454	CLIP-seq
MIRT2009715	hsa-miR-4671-3p	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT2009716	hsa-miR-4704-3p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT2009717	hsa-miR-548ad	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044507	hsa-miR-1203	CLIP-seq
MIRT1044509	hsa-miR-1297	CLIP-seq
MIRT1044510	hsa-miR-1303	CLIP-seq
MIRT1044511	hsa-miR-1305	CLIP-seq
MIRT1044512	hsa-miR-150	CLIP-seq
MIRT1044514	hsa-miR-2110	CLIP-seq
MIRT1044515	hsa-miR-26a	CLIP-seq
MIRT1044516	hsa-miR-26b	CLIP-seq
MIRT1044517	hsa-miR-3150a-3p	CLIP-seq
MIRT1044519	hsa-miR-3175	CLIP-seq
MIRT1044520	hsa-miR-3200-5p	CLIP-seq
MIRT1044521	hsa-miR-323b-3p	CLIP-seq
MIRT2242027	hsa-miR-3613-3p	CLIP-seq
MIRT1044523	hsa-miR-369-3p	CLIP-seq
MIRT1044524	hsa-miR-374a	CLIP-seq
MIRT1044525	hsa-miR-374b	CLIP-seq
MIRT1044526	hsa-miR-374c	CLIP-seq
MIRT1044527	hsa-miR-3909	CLIP-seq
MIRT1044528	hsa-miR-3940-5p	CLIP-seq
MIRT1044529	hsa-miR-4266	CLIP-seq
MIRT1044530	hsa-miR-4272	CLIP-seq
MIRT1044531	hsa-miR-4303	CLIP-seq
MIRT1044532	hsa-miR-4465	CLIP-seq
MIRT1044533	hsa-miR-4484	CLIP-seq
MIRT1044534	hsa-miR-4507	CLIP-seq
MIRT1044535	hsa-miR-4517	CLIP-seq
MIRT1044537	hsa-miR-4695-5p	CLIP-seq
MIRT1044538	hsa-miR-4713-5p	CLIP-seq
MIRT1044539	hsa-miR-4768-5p	CLIP-seq
MIRT1044540	hsa-miR-4779	CLIP-seq
MIRT1044541	hsa-miR-520d-5p	CLIP-seq
MIRT1044542	hsa-miR-524-3p	CLIP-seq
MIRT1044543	hsa-miR-525-3p	CLIP-seq
MIRT1044544	hsa-miR-532-3p	CLIP-seq
MIRT2009717	hsa-miR-548ad	CLIP-seq
MIRT1044545	hsa-miR-607	CLIP-seq
MIRT1044546	hsa-miR-651	CLIP-seq
MIRT1044547	hsa-miR-655	CLIP-seq
MIRT1044548	hsa-miR-9	CLIP-seq
MIRT1044549	hsa-miR-939	CLIP-seq
MIRT1044550	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
LMO3	Repression	21573214
NFKB1	Unknown	17876798
NHLH2	Repression	21573214
NOTCH3	Repression	22117196
PITX1	Repression	21425961
RELA	Unknown	17876798
RUNX3	Repression	19800882
SNW1	Unknown	15546612
SOX9	Activation	19322650

Show/Hide all(100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12032823, 12535671
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001085	Function	RNA polymerase II transcription factor binding	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001889	Process	Liver development	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003266	Process	Regulation of secondary heart field cardioblast proliferation	IEA
GO:0003281	Process	Ventricular septum development	ISS
GO:0003677	Function	DNA binding	TAS	7906273
GO:0005515	Function	Protein binding	IPI	12535671
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007155	Process	Cell adhesion	IEA
GO:0007219	Process	Notch signaling pathway	IBA	21873635
GO:0007219	Process	Notch signaling pathway	IDA	16160079
GO:0007219	Process	Notch signaling pathway	IMP	19682396
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007399	Process	Nervous system development	TAS	8020957
GO:0008134	Function	Transcription factor binding	NAS	17611704
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0009952	Process	Anterior/posterior pattern specification	IBA	21873635
GO:0016477	Process	Cell migration	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0021555	Process	Midbrain-hindbrain boundary morphogenesis	IEA
GO:0021557	Process	Oculomotor nerve development	IEA
GO:0021558	Process	Trochlear nerve development	IEA
GO:0021575	Process	Hindbrain morphogenesis	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	ISS
GO:0021984	Process	Adenohypophysis development	IEA
GO:0030324	Process	Lung development	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035910	Process	Ascending aorta morphogenesis	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	12535671
GO:0043388	Process	Positive regulation of DNA binding	ISS
GO:0043398	Function	HLH domain binding	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	ISS
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045608	Process	Negative regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IBA	21873635
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	12535671
GO:0045893	Process	Positive regulation of transcription, DNA-templated	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045977	Process	Positive regulation of mitotic cell cycle, embryonic	ISS
GO:0046331	Process	Lateral inhibition	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0048469	Process	Cell maturation	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0048844	Process	Artery morphogenesis	ISS
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA	21873635
GO:0051087	Function	Chaperone binding	IEA
GO:0060122	Process	Inner ear receptor cell stereocilium organization	IEA
GO:0060164	Process	Regulation of timing of neuron differentiation	IEA
GO:0060253	Process	Negative regulation of glial cell proliferation	ISS
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060675	Process	Ureteric bud morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061009	Process	Common bile duct development	IEA
GO:0061106	Process	Negative regulation of stomach neuroendocrine cell differentiation	IEA
GO:0061309	Process	Cardiac neural crest cell development involved in outflow tract morphogenesis	IEA
GO:0061626	Process	Pharyngeal arch artery morphogenesis	ISS
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0070888	Function	E-box binding	IBA	21873635
GO:0070888	Function	E-box binding	ISS
GO:0071820	Function	N-box binding	IBA	21873635
GO:0071820	Function	N-box binding	ISS
GO:0072012	Process	Glomerulus vasculature development	IEA
GO:0072049	Process	Comma-shaped body morphogenesis	IEA
GO:0072050	Process	S-shaped body morphogenesis	IEA
GO:0072141	Process	Renal interstitial fibroblast development	IEA
GO:0072282	Process	Metanephric nephron tubule morphogenesis	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	ISS
GO:0097150	Process	Neuronal stem cell population maintenance	IEP	19682396
GO:1905934	Process	Negative regulation of cell fate determination	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000227	Process	Negative regulation of pancreatic A cell differentiation	IEA
GO:2000737	Process	Negative regulation of stem cell differentiation	IMP	19682396
GO:2000974	Process	Negative regulation of pro-B cell differentiation	IMP	12032823
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	ISS

MIM	HGNC	e!Ensembl
139605	5192	ENSG00000114315

Protein

UniProt ID

Q14469

Protein name

Transcription factor HES-1 (Class B basic helix-loop-helix protein 39) (bHLHb39) (Hairy and enhancer of split 1) (Hairy homolog) (Hairy-like protein) (hHL)

Protein function

Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and o

PDB

2MH3 , 7C4O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	35 → 92	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	109 → 148	Hairy Orange	Domain

Sequence

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Sequence length

280

Interactions

View interactions

	KEGG		Reactome
	Fanconi anemia pathway Notch signaling pathway Maturity onset diabetes of the young Human papillomavirus infection Epstein-Barr virus infection Pathways in cancer Breast cancer		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants RUNX3 regulates NOTCH signaling NOTCH4 Intracellular Domain Regulates Transcription

Show/Hide Causal Diseases (11)

Disease term	Disease name	dbSNP ID	References
Causal
Anaplastic oligodendroglioma	Anaplastic Oligodendroglioma	rs1568504941	21127729
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	20197467, 21036696
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	21036696, 20197467
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	25061499
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	19147571
Glioblastoma	Glioblastoma, Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888	21127729
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	21994468
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	17804716
Lymphangiomyomatosis	Lymphangioleiomyomatosis	rs118203388, rs45483392, rs45517179, rs28934872, rs45517148, rs118203537, rs118203707, rs137854360, rs45517169, rs45517299, rs137854210, rs45517213, rs45517132, rs45514095, rs137854157 View all (8 more)	20038814
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	20197467, 21036696
Meningioma	Meningioma, Meningiomas, Multiple, Clear Cell Meningioma	rs587776563, rs121434259, rs387906857, rs397509405, rs797045990, rs876659443, rs878854603, rs1057518166, rs1060501395, rs1554897280, rs1554898242, rs1555605347, rs587782187, rs1555605750, rs878853937 View all (3 more)	21127729

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Microcystic meningioma	Microcystic meningioma	21127729	ClinVar
Oligodendroglioma	oligodendroglioma, Adult Oligodendroglioma, Childhood Oligodendroglioma, Well Differentiated Oligodendroglioma	21127729	ClinVar

Show/Hide Text Mining Associations (98)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	20091184, 21305538
Adenocarcinoma	Associate	23423517
Adenocarcinoma Mucinous	Associate	34582650
Adenocarcinoma of Lung	Associate	37268635
Albuminuria	Associate	30547231
Alzheimer Disease	Associate	16685645
Aortic Aneurysm Thoracic	Associate	23300792
Arthritis Rheumatoid	Associate	22190977
Atypical Squamous Cells of the Cervix	Associate	17388915
Barrett Esophagus	Inhibit	25558829
Biliary Fistula	Associate	23423517
Breast Neoplasms	Associate	20010940, 20030805, 26472724, 30809937, 34725165, 35655918, 40156410
Cap Myopathy	Associate	29453410
Carcinogenesis	Associate	17388915, 18719287, 26650241
Carcinoma Adenoid Cystic	Associate	32025208
Carcinoma Hepatocellular	Associate	25987042
Carcinoma Hepatocellular	Stimulate	27420998
Carcinoma Merkel Cell	Associate	37071208
Carcinoma Non Small Cell Lung	Associate	36411521
Cholesteatoma	Associate	34172659
Cholesteatoma Middle Ear	Associate	34172659
Colonic Neoplasms	Inhibit	37749297
Colorectal Neoplasms	Associate	18219106, 19147571, 23900217, 26452029, 26650241, 26744411
Colorectal Neoplasms	Inhibit	37749297
Death	Stimulate	23900217
Desmoid disease hereditary	Associate	35038826
Developmental Disabilities	Associate	28750047
Diabetes Mellitus Type 2	Associate	29472102
Dissection Thoracic Aorta	Associate	23300792
Down Syndrome	Associate	16685645
Drug Related Side Effects and Adverse Reactions	Associate	30952976
Endometrial Neoplasms	Associate	38096983
Epidermolysis bullosa with pyloric atresia	Associate	25575134
Fanconi Anemia	Associate	19405097
Gastrointestinal Stromal Tumors	Associate	22764137
Glaucoma Open Angle	Associate	28423527
Glioblastoma	Associate	23787764, 26472724, 26662803, 28157712, 33249476, 34761619
Heavy Chain Disease	Inhibit	28157712
Hemangioma Cavernous Central Nervous System	Associate	28181149
Hypersensitivity Immediate	Associate	27888801
Hypoxia	Stimulate	20010940, 25734817
Hypoxia	Inhibit	22172337
Hypoxia	Associate	25166211
Hypoxia Brain	Stimulate	20877435
Hypoxia Brain	Associate	33249476
Infections	Stimulate	28794048
Infections	Inhibit	32265900
Inflammation	Associate	22728043
Intestinal Diseases	Associate	22449796
Kidney Diseases	Associate	24798563
Leprosy	Inhibit	32265900
Leukemia Lymphocytic Chronic B Cell	Stimulate	25849484
Lung Diseases	Inhibit	18219106
Lung Diseases	Associate	29703138
Lung Neoplasms	Associate	31877149
Lymphoma Non Hodgkin	Associate	20017807
Lymphoma T Cell	Associate	35640677
Medulloblastoma	Associate	22411914, 24346283
Meningomyelocele	Associate	28735706
Multiple Myeloma	Associate	15920166
Neoplasm Metastasis	Associate	18219106, 32025208, 37882055
Neoplasm Metastasis	Inhibit	25987042
Neoplasms	Stimulate	16136053, 26349011, 28974890
Neoplasms	Associate	18719287, 19020755, 21663414, 22728043, 23423517, 23900217, 25987042, 26472724, 32298965, 33249476, 34761619, 40156410
Neoplasms	Inhibit	21224467, 37749297
Neoplasms Basal Cell	Associate	25921176
Neuroendocrine Tumors	Associate	22172337, 22918166
Obesity	Associate	26620927
Optic Atrophy Autosomal Dominant	Associate	26620927
Osteosarcoma	Associate	20208568, 37882055
Ovarian Neoplasms	Associate	16136053, 20091184, 37796700
Overweight	Associate	26620927
Pancreatic Neoplasms	Associate	24392017
Pancreatitis	Associate	23235341
Papilloma	Associate	22249263
Pediatric acute onset neuropsychiatric syndrome	Associate	26620927
Polycystic Ovary Syndrome	Associate	21780950
Polyps	Associate	26448192
Polyps	Inhibit	37749297
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	21224467
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24952875
Prostatic Intraepithelial Neoplasia	Associate	26341090
Pulmonary Disease Chronic Obstructive	Associate	29874112, 34354706
Purpura Thrombocytopenic Idiopathic	Inhibit	36202780
Rectal Neoplasms	Associate	34582650
Reperfusion Injury	Associate	29532851
Retinal Dysplasia	Associate	26448192
Retinoblastoma	Associate	27661116
Squamous Cell Carcinoma of Head and Neck	Associate	22728043, 24351288, 32932170, 36142321
Stomach Neoplasms	Associate	21466361, 34925644
Thyroid cancer medullary	Associate	28122586
Thyroid Carcinoma Anaplastic	Associate	24419754
Thyroid Dysgenesis	Associate	30304112
Triple Negative Breast Neoplasms	Associate	27888801, 30952976
Urinary Bladder Neoplasms	Associate	25921176, 36980177
Uterine Cervical Dysplasia	Associate	30615540
Uterine Cervical Neoplasms	Associate	17388915
Vascular Ring	Associate	27208800

HES1 (hes family bHLH transcription factor 1)