APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1)

Gene

• Entrez ID: 328
• Gene name: Apurinic/apyrimidinic endodeoxyribonuclease 1
• Gene symbol: APEX1
• Synonyms (NCBI Gene): APE, APE1, APEN, APEX, APX, HAP1, REF1
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA dama

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050830	hsa-miR-17-5p	CLASH	23622248
MIRT048610	hsa-miR-99a-5p	CLASH	23622248
MIRT048405	hsa-miR-100-5p	CLASH	23622248
MIRT045386	hsa-miR-185-5p	CLASH	23622248
MIRT036701	hsa-miR-935	CLASH	23622248
MIRT481806	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT481805	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT481804	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT481803	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT481802	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT481799	hsa-miR-1197	PAR-CLIP	20371350
MIRT481796	hsa-miR-4678	PAR-CLIP	20371350
MIRT481792	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT481774	hsa-miR-597-5p	PAR-CLIP	20371350
MIRT481770	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT481806	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT481805	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT481804	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT481803	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT481802	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT481801	hsa-miR-3609	PAR-CLIP	23592263
MIRT481800	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT481799	hsa-miR-1197	PAR-CLIP	23592263
MIRT481798	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT481797	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT481796	hsa-miR-4678	PAR-CLIP	23592263
MIRT481795	hsa-miR-1245a	PAR-CLIP	23592263
MIRT481794	hsa-miR-8079	PAR-CLIP	23592263
MIRT481793	hsa-miR-8062	PAR-CLIP	23592263
MIRT481792	hsa-miR-135a-3p	PAR-CLIP	23592263
MIRT481791	hsa-miR-3973	PAR-CLIP	23592263
MIRT481790	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT481789	hsa-miR-520h	PAR-CLIP	23592263
MIRT481788	hsa-miR-6890-3p	PAR-CLIP	23592263
MIRT481787	hsa-miR-3155a	PAR-CLIP	23592263
MIRT481786	hsa-miR-3155b	PAR-CLIP	23592263
MIRT481785	hsa-miR-484	PAR-CLIP	23592263
MIRT481784	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT481783	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT481782	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT481781	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT341107	hsa-miR-27a-5p	PAR-CLIP	23592263
MIRT481780	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT481779	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT481778	hsa-miR-4651	PAR-CLIP	23592263
MIRT481777	hsa-miR-608	PAR-CLIP	23592263
MIRT481776	hsa-miR-1293	PAR-CLIP	23592263
MIRT481775	hsa-miR-4483	PAR-CLIP	23592263
MIRT481774	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT481773	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT481772	hsa-miR-6789-5p	PAR-CLIP	23592263
MIRT481771	hsa-miR-4278	PAR-CLIP	23592263
MIRT481770	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT481769	hsa-miR-7977	PAR-CLIP	23592263
MIRT481768	hsa-miR-2909	PAR-CLIP	23592263
MIRT481803	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT481802	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT481783	hsa-miR-1915-3p	PAR-CLIP	26701625
MIRT481783	hsa-miR-1915-3p	PAR-CLIP	26701625
MIRT341107	hsa-miR-27a-5p	PAR-CLIP	26701625
MIRT341107	hsa-miR-27a-5p	PAR-CLIP	26701625
MIRT481787	hsa-miR-3155a	PAR-CLIP	26701625
MIRT481787	hsa-miR-3155a	PAR-CLIP	26701625
MIRT481786	hsa-miR-3155b	PAR-CLIP	26701625
MIRT481786	hsa-miR-3155b	PAR-CLIP	26701625
MIRT481801	hsa-miR-3609	PAR-CLIP	26701625
MIRT481801	hsa-miR-3609	PAR-CLIP	26701625
MIRT481791	hsa-miR-3973	PAR-CLIP	26701625
MIRT481791	hsa-miR-3973	PAR-CLIP	26701625
MIRT481781	hsa-miR-4726-3p	PAR-CLIP	26701625
MIRT481781	hsa-miR-4726-3p	PAR-CLIP	26701625
MIRT481785	hsa-miR-484	PAR-CLIP	26701625
MIRT481785	hsa-miR-484	PAR-CLIP	26701625
MIRT481790	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT481790	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT481789	hsa-miR-520h	PAR-CLIP	26701625
MIRT481789	hsa-miR-520h	PAR-CLIP	26701625
MIRT481800	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT481800	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT481782	hsa-miR-6764-5p	PAR-CLIP	26701625
MIRT481782	hsa-miR-6764-5p	PAR-CLIP	26701625
MIRT481798	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT481798	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT481784	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT481784	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT481780	hsa-miR-6846-5p	PAR-CLIP	26701625
MIRT481780	hsa-miR-6846-5p	PAR-CLIP	26701625
MIRT481779	hsa-miR-6848-5p	PAR-CLIP	26701625
MIRT481779	hsa-miR-6848-5p	PAR-CLIP	26701625
MIRT481769	hsa-miR-7977	PAR-CLIP	26701625
MIRT481769	hsa-miR-7977	PAR-CLIP	26701625
MIRT481776	hsa-miR-1293	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, In situ hybridization	32320642
MIRT481806	hsa-miR-3681-3p	PAR-CLIP	20371350
MIRT481805	hsa-miR-216a-3p	PAR-CLIP	20371350
MIRT481804	hsa-miR-128-3p	PAR-CLIP	20371350
MIRT481803	hsa-miR-27a-3p	PAR-CLIP	20371350
MIRT481802	hsa-miR-27b-3p	PAR-CLIP	20371350
MIRT481799	hsa-miR-1197	PAR-CLIP	20371350
MIRT481796	hsa-miR-4678	PAR-CLIP	20371350
MIRT481792	hsa-miR-135a-3p	PAR-CLIP	20371350
MIRT481774	hsa-miR-597-5p	PAR-CLIP	20371350
MIRT481770	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT481806	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT481805	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT481804	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT481803	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT481802	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT481801	hsa-miR-3609	PAR-CLIP	23592263
MIRT481800	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT481799	hsa-miR-1197	PAR-CLIP	23592263
MIRT481798	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT481797	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT481796	hsa-miR-4678	PAR-CLIP	23592263
MIRT481795	hsa-miR-1245a	PAR-CLIP	23592263
MIRT481794	hsa-miR-8079	PAR-CLIP	23592263
MIRT481793	hsa-miR-8062	PAR-CLIP	23592263
MIRT481792	hsa-miR-135a-3p	PAR-CLIP	23592263
MIRT481791	hsa-miR-3973	PAR-CLIP	23592263
MIRT481790	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT481789	hsa-miR-520h	PAR-CLIP	23592263
MIRT481788	hsa-miR-6890-3p	PAR-CLIP	23592263
MIRT481787	hsa-miR-3155a	PAR-CLIP	23592263
MIRT481786	hsa-miR-3155b	PAR-CLIP	23592263
MIRT481785	hsa-miR-484	PAR-CLIP	23592263
MIRT481784	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT481783	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT481782	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT481781	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT341107	hsa-miR-27a-5p	PAR-CLIP	23592263
MIRT481780	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT481779	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT481778	hsa-miR-4651	PAR-CLIP	23592263
MIRT481777	hsa-miR-608	PAR-CLIP	23592263
MIRT481776	hsa-miR-1293	PAR-CLIP	23592263
MIRT481775	hsa-miR-4483	PAR-CLIP	23592263
MIRT481774	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT481773	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT481772	hsa-miR-6789-5p	PAR-CLIP	23592263
MIRT481771	hsa-miR-4278	PAR-CLIP	23592263
MIRT481770	hsa-miR-331-5p	PAR-CLIP	23592263
MIRT481769	hsa-miR-7977	PAR-CLIP	23592263
MIRT481768	hsa-miR-2909	PAR-CLIP	23592263
MIRT789085	hsa-miR-1252	CLIP-seq
MIRT789086	hsa-miR-186	CLIP-seq
MIRT789087	hsa-miR-1915	CLIP-seq
MIRT789088	hsa-miR-3133	CLIP-seq
MIRT789089	hsa-miR-3155	CLIP-seq
MIRT789090	hsa-miR-3184	CLIP-seq
MIRT789091	hsa-miR-3613-3p	CLIP-seq
MIRT789092	hsa-miR-3659	CLIP-seq
MIRT789093	hsa-miR-3671	CLIP-seq
MIRT789094	hsa-miR-3921	CLIP-seq
MIRT789095	hsa-miR-4653-5p	CLIP-seq
MIRT789096	hsa-miR-4703-3p	CLIP-seq
MIRT789097	hsa-miR-4709-3p	CLIP-seq
MIRT789098	hsa-miR-4790-3p	CLIP-seq
MIRT789099	hsa-miR-520g	CLIP-seq
MIRT789100	hsa-miR-548ac	CLIP-seq
MIRT789101	hsa-miR-548c-3p	CLIP-seq
MIRT789102	hsa-miR-548d-3p	CLIP-seq
MIRT789103	hsa-miR-548z	CLIP-seq
MIRT789091	hsa-miR-3613-3p	CLIP-seq
MIRT789093	hsa-miR-3671	CLIP-seq
MIRT789104	hsa-miR-4443	CLIP-seq
MIRT789105	hsa-miR-513a-5p	CLIP-seq
MIRT789100	hsa-miR-548ac	CLIP-seq
MIRT789102	hsa-miR-548d-3p	CLIP-seq
MIRT789103	hsa-miR-548z	CLIP-seq
MIRT789106	hsa-miR-765	CLIP-seq
MIRT1932775	hsa-miR-1261	CLIP-seq
MIRT1932776	hsa-miR-384	CLIP-seq
MIRT789104	hsa-miR-4443	CLIP-seq
MIRT1932777	hsa-miR-4760-3p	CLIP-seq
MIRT789105	hsa-miR-513a-5p	CLIP-seq
MIRT789106	hsa-miR-765	CLIP-seq
MIRT2476159	hsa-miR-1244	CLIP-seq
MIRT1932775	hsa-miR-1261	CLIP-seq
MIRT2476160	hsa-miR-135a	CLIP-seq
MIRT2476161	hsa-miR-135b	CLIP-seq
MIRT2476162	hsa-miR-3607-5p	CLIP-seq
MIRT2476163	hsa-miR-3691-5p	CLIP-seq
MIRT2476164	hsa-miR-375	CLIP-seq
MIRT2476165	hsa-miR-4491	CLIP-seq
MIRT2476166	hsa-miR-4657	CLIP-seq
MIRT2476167	hsa-miR-4738-3p	CLIP-seq
MIRT2476168	hsa-miR-4752	CLIP-seq
MIRT1932777	hsa-miR-4760-3p	CLIP-seq
MIRT2476169	hsa-miR-760	CLIP-seq
MIRT2476159	hsa-miR-1244	CLIP-seq
MIRT1932775	hsa-miR-1261	CLIP-seq
MIRT2476160	hsa-miR-135a	CLIP-seq
MIRT2476161	hsa-miR-135b	CLIP-seq
MIRT2476162	hsa-miR-3607-5p	CLIP-seq
MIRT2476163	hsa-miR-3691-5p	CLIP-seq
MIRT2476164	hsa-miR-375	CLIP-seq
MIRT2476165	hsa-miR-4491	CLIP-seq
MIRT2476166	hsa-miR-4657	CLIP-seq
MIRT2476167	hsa-miR-4738-3p	CLIP-seq
MIRT2476168	hsa-miR-4752	CLIP-seq
MIRT1932777	hsa-miR-4760-3p	CLIP-seq
MIRT2476169	hsa-miR-760	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIF1A	Repression	19524065
SP1	Repression	18208837
SP1	Unknown	7534297
USF1	Unknown	7534297

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IDA	24703901
GO:0000781	Component	Chromosome, telomeric region	IC	24703901
GO:0003677	Function	DNA binding	IDA	11286553
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IDA	12524539, 14706345, 24703901
GO:0003691	Function	Double-stranded telomeric DNA binding	IDA	24703901
GO:0003713	Function	Transcription coactivator activity	IDA	9119221, 18809583
GO:0003714	Function	Transcription corepressor activity	TAS	7961715
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IBA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	8932386, 15707971, 18973764, 19188445, 24703901
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	TAS	9119221
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IDA	11478795
GO:0004519	Function	Endonuclease activity	IEA
GO:0004520	Function	DNA endonuclease activity	TAS	1722334
GO:0004523	Function	RNA-DNA hybrid ribonuclease activity	TAS	11286553
GO:0004527	Function	Exonuclease activity	IEA
GO:0004528	Function	Phosphodiesterase I activity	TAS	9119221
GO:0004844	Function	Uracil DNA N-glycosylase activity	TAS
GO:0005515	Function	Protein binding	IPI	8621488, 9108029, 9207062, 11118054, 11809897, 12524539, 15518571, 15942031, 18809583, 19188445, 19465398, 19505873, 19934257, 20231292, 20696907, 20808282, 20856196, 26760506, 28514442, 32911434, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9119221, 15942031, 19934257, 28404743
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17148573
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	17148573, 19188445
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	9560228
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20231292
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	12524539
GO:0005813	Component	Centrosome	IDA
GO:0005840	Component	Ribosome	TAS	12524539
GO:0006281	Process	DNA repair	IDA	1627644, 9560228
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IBA
GO:0006284	Process	Base-excision repair	IDA	8932386
GO:0006287	Process	Base-excision repair, gap-filling	TAS
GO:0006308	Process	DNA catabolic process	IDA	1627644
GO:0006310	Process	DNA recombination	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IBA
GO:0008081	Function	Phosphoric diester hydrolase activity	IDA	11478795, 18973764
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	1627644
GO:0008309	Function	Double-stranded DNA exodeoxyribonuclease activity	IDA	24703901
GO:0008311	Function	Double-stranded DNA 3'-5' DNA exonuclease activity	IBA
GO:0008408	Function	3'-5' exonuclease activity	IDA	11832948
GO:0008408	Function	3'-5' exonuclease activity	TAS	11286553
GO:0016491	Function	Oxidoreductase activity	IDA	9119221, 12524539
GO:0016607	Component	Nuclear speck	IDA	17148573
GO:0016607	Component	Nuclear speck	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	11809897
GO:0033892	Function	Deoxyribonuclease (pyrimidine dimer) activity	IDA	19188445, 24703901
GO:0042981	Process	Regulation of apoptotic process	IDA	19934257
GO:0043488	Process	Regulation of mRNA stability	IMP	19401441
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IDA	21496894
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18809583
GO:0046872	Function	Metal ion binding	IDA	11286553
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12524539
GO:0052720	Function	Class II DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	1627644, 9804798, 11160897, 11286553
GO:0090580	Function	Phosphodiesterase activity, acting on 3'-phosphoglycolate-terminated DNA strands	IDA	1627644
GO:0097698	Process	Telomere maintenance via base-excision repair	IDA	24703901
GO:0140431	Function	DNA-(abasic site) binding	IMP	9804798

Other IDs

• MIM: 107748
• HGNC: 587
• e!Ensembl: ENSG00000100823

Protein

• UniProt ID: P27695
• Protein name: DNA repair nuclease/redox regulator APEX1 (EC 3.1.11.2) (EC 3.1.21.-) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (APE-1) (DNA-(apurinic or apyrimidinic site) endonuclease) (Redox factor-1) (REF-1) [Cleaved into: DNA
• Protein function: Multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are DNA repair and redox regulation of transcriptional factors (PubMed:11118054, PubMed:11452037, PubMed:15831793,
• PDB: 1BIX, 1CQG, 1CQH, 1DE8, 1DE9, 1DEW, 1E9N, 1HD7, 2ISI, 2O3H, 3U8U, 4IEM, 4LND, 4QH9, 4QHD, 4QHE, 5CFG, 5DFF, 5DFH, 5DFI, 5DFJ, 5DG0, 5WN0, 5WN1, 5WN2, 5WN3, 5WN4, 5WN5, 6BOQ, 6BOR, 6BOS, 6BOT, 6BOU, 6BOV, 6BOW, 6MK3, 6MKK, 6MKM, 6MKO, 6P93, 6P94, 6W0Q, 6W2P, 6W3L, 6W3N, 6W3Q, 6W3U, 6W43, 6W4I, 6W4T, 7LPG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03372	Exo_endo_phos	65 → 309	Endonuclease/Exonuclease/phosphatase family	Domain

• Sequence:

  MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
  TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
  APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
  RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
  GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
  RSKALGSDHCPITLYLAL

• Sequence length: 318

Pathways

KEGG:

Base excision repair

Reactome:

Displacement of DNA glycosylase by APEX1
POLB-Dependent Long Patch Base Excision Repair
Resolution of AP sites via the multiple-nucleotide patch replacement pathway
PCNA-Dependent Long Patch Base Excision Repair
Abasic sugar-phosphate removal via the single-nucleotide replacement pathway
Resolution of Abasic Sites (AP sites)

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Amyotrophic Lateral Sclerosis	amyotrophic lateral sclerosis	N/A	N/A	GenCC
head and neck cancer	Head and neck cancer	N/A	N/A	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	18478337, 19414392, 21198260, 26934647, 31308045, 33887608
Adenocarcinoma	Stimulate	29991802
Adenocarcinoma of Lung	Associate	23781133, 23951099
Adenoma	Associate	20534734, 23951112, 34126796
Amyotrophic Lateral Sclerosis	Associate	32005289
Anophthalmia with pulmonary hypoplasia	Associate	23094050
Barrett Esophagus	Associate	29991802, 33887608
beta Thalassemia	Associate	31218684
Bile Reflux	Associate	26934647
Breast Neoplasms	Associate	18701435, 19460860, 23631762, 23755158, 24606430, 24642895, 24914806, 25111287, 25292033, 26125438, 26257461, 29720094
Calcinosis	Associate	28515448
Carcinogenesis	Associate	25268610, 28464393, 31308045, 35485688, 35780128
Carcinoma Adenoid Cystic	Associate	33202356
Carcinoma Ductal Breast	Associate	37175345
Carcinoma Embryonal	Associate	22788932
Carcinoma Hepatocellular	Associate	17515960, 22691054, 25026174, 26367730, 30473552, 32167932, 33028238, 34045188, 36456877
Carcinoma Hepatocellular	Stimulate	25109342, 26624999
Carcinoma in Situ	Associate	24292451, 32801084
Carcinoma Non Small Cell Lung	Stimulate	18809583
Carcinoma Non Small Cell Lung	Associate	20540786, 21325978, 21420246, 23038158, 23472128, 23509821, 23781133, 27813497, 32529467, 33676448, 35059870, 35780128, 37774051, 38401056
Carcinoma Ovarian Epithelial	Associate	19032793
Carcinoma Pancreatic Ductal	Associate	25492865, 27535970, 28922540, 30214007, 35286386, 36674619
Carcinoma Renal Cell	Associate	32056986
Carcinoma Squamous Cell	Associate	21198260
Cataract	Associate	26884880
Chemical and Drug Induced Liver Injury	Associate	23967134
Cholangiocarcinoma	Stimulate	31454981
Cholangiocarcinoma	Associate	33946672
Cognition Disorders	Associate	34966960
Colitis Ulcerative	Stimulate	14679184
Colonic Polyps	Associate	34126796
Colorectal Neoplasms	Associate	18823566, 20534734, 25024628, 25268610, 27022219, 31450087, 32312920, 37652525
Death	Associate	20332233, 26238022
Depressive Disorder	Stimulate	19272208
Diabetes Gestational	Inhibit	27019630
Diabetes Mellitus	Associate	27019630
Diabetic Nephropathies	Associate	37316538
Disease Resistance	Associate	20856196
DNA Virus Infections	Associate	24646203, 36894994
Drug Hypersensitivity	Associate	24335147
Drug Related Side Effects and Adverse Reactions	Associate	15316562, 19726241, 21266972, 31307523, 32124937
Drug Related Side Effects and Adverse Reactions	Stimulate	22788932
Dry Eye Syndromes	Associate	30312344
Early onset ataxia with oculomotor apraxia and hypoalbuminemia	Associate	25976310
Embryo Loss	Associate	23776569
Endometrial Neoplasms	Associate	23776569
Ependymoma	Associate	21207372, 25681012
Esophageal Neoplasms	Associate	24284961
Esophageal Squamous Cell Carcinoma	Associate	24284961, 24551299
Fibrosis	Associate	23597419
Fibrosis	Stimulate	26624999
Gastritis	Associate	20332233
Gastroesophageal Reflux	Associate	33887608
Gastrointestinal Diseases	Associate	19376732
Glaucoma Angle Closure	Associate	28396513
Glaucoma Open Angle	Associate	24375045
Glioblastoma	Associate	20504914, 21429202, 26520369, 27148961, 28852018
Glioma	Associate	19124499, 20679741, 21266972, 21429202, 37086071
Head and Neck Neoplasms	Associate	25916209
Hearing Loss Noise Induced	Associate	31827649
Helicobacter Infections	Stimulate	19505426
Helicobacter Infections	Associate	20332233
Huntington Disease	Associate	27182645
Hypoxia	Associate	14742261, 20540786, 25026297, 27535970, 30214007, 32124937
Hypoxia	Stimulate	8065332
Hypoxia Brain	Associate	14742261
Infarction	Associate	14742261
Infections	Associate	20332233
Infertility Female	Associate	26790616
Inflammation	Stimulate	14679184
Inflammation	Associate	19376732, 23967134, 26316174, 27388124, 31218684, 36674619
Inflammation	Inhibit	23509821, 24213673
Kidney Calculi	Associate	31926579
Kidney Diseases	Associate	31926579
Leukemia Myeloid	Associate	20826193
Liver Diseases	Associate	26624999
Liver Neoplasms	Associate	23967134
Lung Diseases	Associate	36674619
Lung Neoplasms	Associate	15816625, 19528510, 21198260, 21429202, 23038158, 23443124, 23509821, 23874853, 23951099, 24884729, 25858321, 26045303, 30991224, 32641008, 34708297, 34824168, 35780128, 35876890, 38028841
Lupus Erythematosus Systemic	Associate	31494269
Lymphatic Metastasis	Associate	22205985, 25733810, 37652525
Lymphatic Metastasis	Stimulate	32801084
Lymphoma Large B Cell Diffuse	Associate	34708297
Malformations of Cortical Development Group I	Inhibit	20332233
Medulloblastoma	Associate	25681012
Melanoma	Associate	16373707, 18971960, 19074850, 21266972, 24830350, 26445994
Meningitis Bacterial	Associate	26316174
Microsatellite Instability	Associate	14679184
Mitochondrial Diseases	Inhibit	21865600
Multi centric Castleman's Disease	Associate	28380040
Multiple Myeloma	Associate	24400589, 30301882
Multiple Myeloma	Stimulate	31784427
Myocardial Infarction	Associate	18712175
Myotonic Dystrophy	Inhibit	27019630
Nasopharyngeal Carcinoma	Associate	24175791, 28464393
Neoplasm Invasiveness	Associate	14742261
Neoplasm Metastasis	Associate	19414392, 20218738, 21865600, 27388124, 28839218, 33946672, 37652525
Neoplasm Metastasis	Stimulate	25109342, 31454981
Neoplasms	Associate	14742261, 15330152, 16113242, 17177211, 18042731, 18208837, 18645011, 18809583, 19074850, 20067291, 20087352, 20504914, 20856196, 20963646, 21113933, 21207372, 21266972, 21429202, 21615620, 21865600, 21935361, 22205985, 22649278, 23094050, 23109358, 23110144, 23472128, 23776569, 23874636, 24257553, 24830350, 24914806, 25026174, 25109342, 25268610, 25292033, 25492865, 25672588, 25865359, 26134573, 26238022, 26624999, 26934647, 27050370, 27388124, 27535970, 27608656, 27655688, 27802207, 28852018, 28922540, 28986522, 29064327, 30473552, 30991224, 31307523, 31430071, 31450087, 31913336, 32454397, 33028238, 33202356, 33676448, 34126796, 34824168, 35780128, 35943146, 36674619, 37175345, 37652525, 37887269
Neoplasms	Stimulate	30214007
Neoplasms Glandular and Epithelial	Associate	19414392
Neoplasms Second Primary	Associate	21420246
Neuroblastoma	Associate	31341530
Neurofibrosarcoma	Associate	36674619
Neurotoxicity Syndromes	Associate	27608656
Neutropenia	Associate	28882023
Niemann Pick Disease Type C	Inhibit	24175791
Niemann Pick Disease Type C	Associate	24175791
Non alcoholic Fatty Liver Disease	Associate	37511066
Non Muscle Invasive Bladder Neoplasms	Associate	25672588
Osteoglophonic dwarfism	Inhibit	32124937
Osteosarcoma	Associate	20218738, 25418192, 28839218, 32627008
Ovarian Neoplasms	Associate	20087352, 24257553, 27802207, 38143770
Pancreatic Neoplasms	Associate	15316562, 17230526, 18645011, 22850545, 23094050, 28922540, 30214007
Pancreatic Neoplasms	Inhibit	20919954
Pancreatic Neoplasms	Stimulate	32438692
Peripheral Nervous System Diseases	Associate	27608656
Personality Disorders	Associate	20963646, 25865359
Polypoidal Choroidal Vasculopathy	Associate	37887269
Pre Eclampsia	Associate	24619222
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	28882023
Preeclamptic toxemia	Associate	24619222
Prostatic Neoplasms	Associate	19101986
Radiation Pneumonitis	Associate	21420246, 22541966, 24884729
Rectal Neoplasms	Associate	25268610
Recurrence	Associate	20218738
Reperfusion Injury	Associate	14742261, 32124937
Retinal Dysplasia	Associate	31308045
Salivary Gland Neoplasms	Associate	33202356
Sjogren's Syndrome	Associate	30312344
Smoke Inhalation Injury	Associate	21198260
Squamous Cell Carcinoma of Head and Neck	Associate	17614107, 24622884, 32801084, 33714009, 37887269
Stomach Neoplasms	Associate	20332233, 21615620, 22205985, 25733810
Stomach Ulcer	Associate	20332233
Tarlov Cysts	Associate	37652525
Triple Negative Breast Neoplasms	Associate	26125438, 29064327, 31307523
Tuberculosis Multidrug Resistant	Associate	18809583, 20856196
Urinary Bladder Neoplasms	Associate	17898541, 19414392, 26238022, 27153553
Urinary Bladder Neoplasms	Stimulate	25672588, 27057081, 27153553
Uterine Cervical Neoplasms	Associate	14742261, 18503157, 32711433, 35485688, 36894994
Uterine Cervical Neoplasms	Inhibit	25858321
Vision Disorders	Associate	24375045
Vitiligo	Associate	31430071
Wounds and Injuries	Associate	32124937