Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	3275
Gene name	Protein arginine methyltransferase 2
Gene symbol	PRMT2
Synonyms (NCBI Gene)	HRMT1L1
Chromosome	21
Chromosome location	21q22.3

180

Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050766	hsa-miR-17-3p	CLASH	23622248
MIRT1264528	hsa-miR-1208	CLIP-seq
MIRT1264529	hsa-miR-1224-3p	CLIP-seq
MIRT1264530	hsa-miR-1260	CLIP-seq
MIRT1264531	hsa-miR-1260b	CLIP-seq
MIRT1264532	hsa-miR-1280	CLIP-seq
MIRT1264533	hsa-miR-21	CLIP-seq
MIRT1264534	hsa-miR-3144-5p	CLIP-seq
MIRT1264535	hsa-miR-3166	CLIP-seq
MIRT1264536	hsa-miR-3190	CLIP-seq
MIRT1264537	hsa-miR-3191	CLIP-seq
MIRT1264538	hsa-miR-338-5p	CLIP-seq
MIRT1264539	hsa-miR-3616-3p	CLIP-seq
MIRT1264540	hsa-miR-3670	CLIP-seq
MIRT1264541	hsa-miR-3682-5p	CLIP-seq
MIRT1264542	hsa-miR-3684	CLIP-seq
MIRT1264543	hsa-miR-3689d	CLIP-seq
MIRT1264544	hsa-miR-3914	CLIP-seq
MIRT1264545	hsa-miR-4266	CLIP-seq
MIRT1264546	hsa-miR-4436b-3p	CLIP-seq
MIRT1264547	hsa-miR-4491	CLIP-seq
MIRT1264548	hsa-miR-4652-5p	CLIP-seq
MIRT1264549	hsa-miR-4657	CLIP-seq
MIRT1264550	hsa-miR-4695-5p	CLIP-seq
MIRT1264551	hsa-miR-4704-3p	CLIP-seq
MIRT1264552	hsa-miR-4777-5p	CLIP-seq
MIRT1264553	hsa-miR-4779	CLIP-seq
MIRT1264554	hsa-miR-4803	CLIP-seq
MIRT1264555	hsa-miR-491-5p	CLIP-seq
MIRT1264556	hsa-miR-5096	CLIP-seq
MIRT1264557	hsa-miR-513b	CLIP-seq
MIRT1264558	hsa-miR-518d-5p	CLIP-seq
MIRT1264559	hsa-miR-519b-5p	CLIP-seq
MIRT1264560	hsa-miR-519c-5p	CLIP-seq
MIRT1264561	hsa-miR-520c-5p	CLIP-seq
MIRT1264562	hsa-miR-526a	CLIP-seq
MIRT1264563	hsa-miR-590-5p	CLIP-seq
MIRT1264564	hsa-miR-1913	CLIP-seq
MIRT1264565	hsa-miR-22	CLIP-seq
MIRT1264566	hsa-miR-3136-5p	CLIP-seq
MIRT1264567	hsa-miR-320a	CLIP-seq
MIRT1264568	hsa-miR-320b	CLIP-seq
MIRT1264569	hsa-miR-320c	CLIP-seq
MIRT1264570	hsa-miR-320d	CLIP-seq
MIRT1264571	hsa-miR-324-3p	CLIP-seq
MIRT1264572	hsa-miR-4429	CLIP-seq
MIRT1264573	hsa-miR-4439	CLIP-seq
MIRT1264574	hsa-miR-4513	CLIP-seq
MIRT1264575	hsa-miR-4667-3p	CLIP-seq
MIRT1264576	hsa-miR-4749-3p	CLIP-seq
MIRT1264577	hsa-miR-4766-5p	CLIP-seq
MIRT1264578	hsa-miR-1291	CLIP-seq
MIRT1264579	hsa-miR-134	CLIP-seq
MIRT1264580	hsa-miR-1470	CLIP-seq
MIRT1264581	hsa-miR-23a	CLIP-seq
MIRT1264582	hsa-miR-23b	CLIP-seq
MIRT1264583	hsa-miR-23c	CLIP-seq
MIRT1264584	hsa-miR-2467-5p	CLIP-seq
MIRT1264585	hsa-miR-3118	CLIP-seq
MIRT1264586	hsa-miR-3128	CLIP-seq
MIRT1264587	hsa-miR-328	CLIP-seq
MIRT1264588	hsa-miR-342-5p	CLIP-seq
MIRT1264589	hsa-miR-34a	CLIP-seq
MIRT1264590	hsa-miR-34c-5p	CLIP-seq
MIRT1264591	hsa-miR-365	CLIP-seq
MIRT1264592	hsa-miR-3925-5p	CLIP-seq
MIRT1264593	hsa-miR-4469	CLIP-seq
MIRT1264594	hsa-miR-449a	CLIP-seq
MIRT1264595	hsa-miR-449b	CLIP-seq
MIRT1264596	hsa-miR-4651	CLIP-seq
MIRT1264597	hsa-miR-4664-5p	CLIP-seq
MIRT1264575	hsa-miR-4667-3p	CLIP-seq
MIRT1264598	hsa-miR-4715-3p	CLIP-seq
MIRT1264599	hsa-miR-4720-5p	CLIP-seq
MIRT1264600	hsa-miR-4799-3p	CLIP-seq
MIRT1264601	hsa-miR-483-3p	CLIP-seq
MIRT1264556	hsa-miR-5096	CLIP-seq
MIRT1264602	hsa-miR-608	CLIP-seq
MIRT1264603	hsa-miR-628-5p	CLIP-seq
MIRT1264604	hsa-miR-652	CLIP-seq
MIRT1264605	hsa-miR-760	CLIP-seq
MIRT1264581	hsa-miR-23a	CLIP-seq
MIRT1264582	hsa-miR-23b	CLIP-seq
MIRT1264583	hsa-miR-23c	CLIP-seq
MIRT1552569	hsa-miR-3647-3p	CLIP-seq
MIRT1552570	hsa-miR-4282	CLIP-seq
MIRT1264598	hsa-miR-4715-3p	CLIP-seq
MIRT1264556	hsa-miR-5096	CLIP-seq
MIRT1556846	hsa-miR-3613-5p	CLIP-seq
MIRT2077815	hsa-miR-190	CLIP-seq
MIRT2077816	hsa-miR-190b	CLIP-seq
MIRT2077817	hsa-miR-4656	CLIP-seq
MIRT2077818	hsa-miR-513a-5p	CLIP-seq
MIRT2077819	hsa-miR-602	CLIP-seq
MIRT2457197	hsa-miR-1285	CLIP-seq
MIRT1264535	hsa-miR-3166	CLIP-seq
MIRT2457198	hsa-miR-3187-5p	CLIP-seq
MIRT1264539	hsa-miR-3616-3p	CLIP-seq
MIRT1264546	hsa-miR-4436b-3p	CLIP-seq
MIRT1264552	hsa-miR-4777-5p	CLIP-seq
MIRT1264558	hsa-miR-518d-5p	CLIP-seq
MIRT1264559	hsa-miR-519b-5p	CLIP-seq
MIRT1264560	hsa-miR-519c-5p	CLIP-seq
MIRT1264561	hsa-miR-520c-5p	CLIP-seq
MIRT1264562	hsa-miR-526a	CLIP-seq
MIRT2457199	hsa-miR-612	CLIP-seq
MIRT2457200	hsa-miR-885-3p	CLIP-seq
MIRT2601183	hsa-miR-122	CLIP-seq
MIRT2601184	hsa-miR-1255a	CLIP-seq
MIRT2601185	hsa-miR-1255b	CLIP-seq
MIRT2601186	hsa-miR-146b-3p	CLIP-seq
MIRT2601187	hsa-miR-188-3p	CLIP-seq
MIRT2077815	hsa-miR-190	CLIP-seq
MIRT2077816	hsa-miR-190b	CLIP-seq
MIRT2601188	hsa-miR-1914	CLIP-seq
MIRT2601189	hsa-miR-19a	CLIP-seq
MIRT2601190	hsa-miR-19b	CLIP-seq
MIRT1264533	hsa-miR-21	CLIP-seq
MIRT2601191	hsa-miR-3681	CLIP-seq
MIRT1264542	hsa-miR-3684	CLIP-seq
MIRT2601192	hsa-miR-3691-5p	CLIP-seq
MIRT1264544	hsa-miR-3914	CLIP-seq
MIRT2601193	hsa-miR-4261	CLIP-seq
MIRT2601194	hsa-miR-4265	CLIP-seq
MIRT2601195	hsa-miR-4280	CLIP-seq
MIRT2601196	hsa-miR-4296	CLIP-seq
MIRT2601197	hsa-miR-4318	CLIP-seq
MIRT2601198	hsa-miR-4322	CLIP-seq
MIRT2601199	hsa-miR-4417	CLIP-seq
MIRT2601200	hsa-miR-4633-3p	CLIP-seq
MIRT2077817	hsa-miR-4656	CLIP-seq
MIRT2601201	hsa-miR-4691-3p	CLIP-seq
MIRT2601202	hsa-miR-4802-3p	CLIP-seq
MIRT2077818	hsa-miR-513a-5p	CLIP-seq
MIRT2601203	hsa-miR-551a	CLIP-seq
MIRT2601204	hsa-miR-551b	CLIP-seq
MIRT1264563	hsa-miR-590-5p	CLIP-seq
MIRT2077819	hsa-miR-602	CLIP-seq
MIRT2601205	hsa-miR-619	CLIP-seq
MIRT2601206	hsa-miR-875-3p	CLIP-seq
MIRT2601183	hsa-miR-122	CLIP-seq
MIRT2601184	hsa-miR-1255a	CLIP-seq
MIRT2601185	hsa-miR-1255b	CLIP-seq
MIRT2601186	hsa-miR-146b-3p	CLIP-seq
MIRT2601187	hsa-miR-188-3p	CLIP-seq
MIRT2077815	hsa-miR-190	CLIP-seq
MIRT2077816	hsa-miR-190b	CLIP-seq
MIRT2601188	hsa-miR-1914	CLIP-seq
MIRT2601189	hsa-miR-19a	CLIP-seq
MIRT2601190	hsa-miR-19b	CLIP-seq
MIRT1264533	hsa-miR-21	CLIP-seq
MIRT2601191	hsa-miR-3681	CLIP-seq
MIRT1264541	hsa-miR-3682-5p	CLIP-seq
MIRT1264542	hsa-miR-3684	CLIP-seq
MIRT2601192	hsa-miR-3691-5p	CLIP-seq
MIRT1264544	hsa-miR-3914	CLIP-seq
MIRT2601193	hsa-miR-4261	CLIP-seq
MIRT2601194	hsa-miR-4265	CLIP-seq
MIRT2601195	hsa-miR-4280	CLIP-seq
MIRT2601196	hsa-miR-4296	CLIP-seq
MIRT2601197	hsa-miR-4318	CLIP-seq
MIRT2601198	hsa-miR-4322	CLIP-seq
MIRT2601199	hsa-miR-4417	CLIP-seq
MIRT2601200	hsa-miR-4633-3p	CLIP-seq
MIRT2077817	hsa-miR-4656	CLIP-seq
MIRT2601201	hsa-miR-4691-3p	CLIP-seq
MIRT1264552	hsa-miR-4777-5p	CLIP-seq
MIRT2601202	hsa-miR-4802-3p	CLIP-seq
MIRT2077818	hsa-miR-513a-5p	CLIP-seq
MIRT1264558	hsa-miR-518d-5p	CLIP-seq
MIRT1264559	hsa-miR-519b-5p	CLIP-seq
MIRT1264560	hsa-miR-519c-5p	CLIP-seq
MIRT1264561	hsa-miR-520c-5p	CLIP-seq
MIRT1264562	hsa-miR-526a	CLIP-seq
MIRT2601203	hsa-miR-551a	CLIP-seq
MIRT2601204	hsa-miR-551b	CLIP-seq
MIRT1264563	hsa-miR-590-5p	CLIP-seq
MIRT2077819	hsa-miR-602	CLIP-seq
MIRT2601205	hsa-miR-619	CLIP-seq
MIRT2601206	hsa-miR-875-3p	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	12039952
GO:0005515	Function	Protein binding	IPI	11513728, 12039952, 16616919, 16648481, 17500595, 17925405, 21653829, 22093364, 26420826, 26871637, 28514442, 33961781, 38892217
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11513728, 17587566
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9545638
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11513728, 17587566, 38892217
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	17587566
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006479	Process	Protein methylation	TAS	9545638
GO:0007165	Process	Signal transduction	TAS	9545638
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IBA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	17587566
GO:0030331	Function	Nuclear estrogen receptor binding	IPI	12039952
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16648481
GO:0032259	Process	Methylation	IEA
GO:0033142	Function	Nuclear progesterone receptor binding	IPI	12039952
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IEA
GO:0042054	Function	Histone methyltransferase activity	IBA
GO:0042054	Function	Histone methyltransferase activity	IDA	19405910
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12039952
GO:0042974	Function	Nuclear retinoic acid receptor binding	IPI	12039952
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IPI	12039952
GO:0043065	Process	Positive regulation of apoptotic process	IGI	16648481
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	38892217
GO:0044877	Function	Protein-containing complex binding	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16648481
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12039952
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IPI	12039952
GO:0048588	Process	Developmental cell growth	ISS
GO:0050681	Function	Nuclear androgen receptor binding	IPI	17587566
GO:0050728	Process	Negative regulation of inflammatory response	IMP	38892217
GO:0060765	Process	Regulation of androgen receptor signaling pathway	IDA	17587566
GO:0140592	Function	Histone H3R8 methyltransferase activity	ISS
GO:0140938	Function	Histone H3 methyltransferase activity	ISS
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	ISS

MIM	HGNC	e!Ensembl
601961	5186	ENSG00000160310

P55345

Protein name

Protein arginine N-methyltransferase 2 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT2)

Protein function

Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (

PDB

1X2P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	36 → 81	SH3 domain	Domain
PF05175	MTS	125 → 212	Methyltransferase small domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord. {ECO:0000269|PubMed:17587566}.

Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
RQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
RTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLV
LQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVI
WPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL
SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLS
TGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT
SQKVGEKVFPIWR

Sequence length

433

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	22093364, 24911119, 29620287, 37173306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	24911119, 37173306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	37863263	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	37173306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37863263	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 21 ring	Associate	35361402	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome Disorders	Associate	24911119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	32121248	★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Associate	31759545, 33494993	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Stimulate	30382083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	37173306, 37863263	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	30382083	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	37949879	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	22093364	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	24911119, 37173306	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24911119, 30382083, 34439753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	34439753	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRMT2 (protein arginine methyltransferase 2)