HRG (histidine rich glycoprotein)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3273
Gene name Gene Name - the full gene name approved by the HGNC.
Histidine rich glycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HRG
Synonyms (NCBI Gene) Gene synonyms aliases
HPRG, HRGP, THPH11
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.
This histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. The encoded protein a
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT1054641 hsa-miR-140-5p CLIP-seq
MIRT1054642 hsa-miR-3133 CLIP-seq
MIRT1054643 hsa-miR-3545-5p CLIP-seq
MIRT1054644 hsa-miR-4460 CLIP-seq
MIRT1054645 hsa-miR-4511 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(60)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0002839 Process Positive regulation of immune response to tumor cell IBA
GO:0002839 Process Positive regulation of immune response to tumor cell IDA 21215706
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
142640 5181 ENSG00000113905
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P04196
Protein name Histidine-rich glycoprotein (Histidine-proline-rich glycoprotein) (HPRG)
Protein function Plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions. Binds heparin and heparin/glycosaminoglycans in a zinc-dependent manner. Binds heparan sulfate on th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00031 Cystatin 18 → 107 Cystatin domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in macrophages and in malignant cells. Expressed by the liver and secreted in plasma (at protein level). {ECO:0000269|PubMed:14744774, ECO:0000269|PubMed:19903770, ECO:0000269|PubMed:21215706}.
Sequence 
MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR
VENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLR
VIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRI
ERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVIN
CEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQH
PHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSF
PLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK
Sequence length 525
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Platelet degranulation
Dissolution of Fibrin Clot
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary Thrombophilia hereditary thrombophilia due to congenital histidine-rich (poly-l) glycoprotein deficiency rs121918122, rs761776963 N/A
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Otosclerosis Otosclerosis N/A N/A GWAS
Show/Hide Text Mining Associations (35)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 25064236
Abortion Spontaneous Associate 23672470, 25064236, 27210772
Acute On Chronic Liver Failure Associate 30867825
Adenocarcinoma of Lung Associate 37576511
Anemia Aplastic Associate 35571618
Bacterial Infections Associate 37244517
Blood Coagulation Disorders Associate 34232570
Brain Concussion Associate 36834989
Breast Neoplasms Associate 11134179, 18355957, 19386091, 21467033
Calcinosis Cutis Associate 27662660