Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	326624
Gene name Gene Name - the full gene name approved by the HGNC.	RAB37, member RAS oncogene family
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAB37
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.[supplied by OMIM, Apr 2006]

Show/Hide all(125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017801	hsa-miR-335-5p	Microarray	18185580
MIRT534809	hsa-miR-545-5p	HITS-CLIP	23824327
MIRT640626	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT640625	hsa-miR-4673	HITS-CLIP	23824327
MIRT534808	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT534807	hsa-miR-558	HITS-CLIP	23824327
MIRT534809	hsa-miR-545-5p	PAR-CLIP	22012620
MIRT534808	hsa-miR-17-3p	PAR-CLIP	22012620
MIRT534807	hsa-miR-558	PAR-CLIP	22012620
MIRT534806	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT534805	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT534809	hsa-miR-545-5p	HITS-CLIP	23824327
MIRT640626	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT640625	hsa-miR-4673	HITS-CLIP	23824327
MIRT534808	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT534807	hsa-miR-558	HITS-CLIP	23824327
MIRT534809	hsa-miR-545-5p	PAR-CLIP	22012620
MIRT534808	hsa-miR-17-3p	PAR-CLIP	22012620
MIRT534807	hsa-miR-558	PAR-CLIP	22012620
MIRT534806	hsa-miR-4763-5p	PAR-CLIP	22012620
MIRT534805	hsa-miR-6894-3p	PAR-CLIP	22012620
MIRT1283797	hsa-miR-10a	CLIP-seq
MIRT1283798	hsa-miR-10b	CLIP-seq
MIRT1283799	hsa-miR-1254	CLIP-seq
MIRT1283800	hsa-miR-1285	CLIP-seq
MIRT1283801	hsa-miR-3116	CLIP-seq
MIRT1283802	hsa-miR-3187-5p	CLIP-seq
MIRT1283803	hsa-miR-3919	CLIP-seq
MIRT1283804	hsa-miR-3925-5p	CLIP-seq
MIRT1283805	hsa-miR-4476	CLIP-seq
MIRT1283806	hsa-miR-4514	CLIP-seq
MIRT1283807	hsa-miR-4692	CLIP-seq
MIRT1283808	hsa-miR-4711-3p	CLIP-seq
MIRT1283809	hsa-miR-4773	CLIP-seq
MIRT1283810	hsa-miR-612	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq
MIRT1283812	hsa-miR-940	CLIP-seq
MIRT1283800	hsa-miR-1285	CLIP-seq
MIRT1283802	hsa-miR-3187-5p	CLIP-seq
MIRT1283813	hsa-miR-3664-3p	CLIP-seq
MIRT1283810	hsa-miR-612	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq
MIRT1283814	hsa-miR-873	CLIP-seq
MIRT1283815	hsa-miR-105	CLIP-seq
MIRT1283816	hsa-miR-1224-3p	CLIP-seq
MIRT1283817	hsa-miR-1226	CLIP-seq
MIRT1283818	hsa-miR-1260	CLIP-seq
MIRT1283819	hsa-miR-1260b	CLIP-seq
MIRT1283820	hsa-miR-1280	CLIP-seq
MIRT1283800	hsa-miR-1285	CLIP-seq
MIRT1283802	hsa-miR-3187-5p	CLIP-seq
MIRT1283821	hsa-miR-3622a-3p	CLIP-seq
MIRT1283822	hsa-miR-3622b-3p	CLIP-seq
MIRT1283813	hsa-miR-3664-3p	CLIP-seq
MIRT1283823	hsa-miR-4267	CLIP-seq
MIRT1283824	hsa-miR-4418	CLIP-seq
MIRT1283825	hsa-miR-4505	CLIP-seq
MIRT1283826	hsa-miR-4696	CLIP-seq
MIRT1283827	hsa-miR-4731-5p	CLIP-seq
MIRT1283828	hsa-miR-4766-5p	CLIP-seq
MIRT1283829	hsa-miR-509-3-5p	CLIP-seq
MIRT1283830	hsa-miR-509-5p	CLIP-seq
MIRT1283831	hsa-miR-548ae	CLIP-seq
MIRT1283832	hsa-miR-548aj	CLIP-seq
MIRT1283833	hsa-miR-548am	CLIP-seq
MIRT1283834	hsa-miR-548x	CLIP-seq
MIRT1283810	hsa-miR-612	CLIP-seq
MIRT1283835	hsa-miR-615-5p	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq
MIRT1283836	hsa-miR-665	CLIP-seq
MIRT1283814	hsa-miR-873	CLIP-seq
MIRT1283837	hsa-miR-888	CLIP-seq
MIRT1283838	hsa-miR-3122	CLIP-seq
MIRT1283839	hsa-miR-3689a-3p	CLIP-seq
MIRT1283840	hsa-miR-3689c	CLIP-seq
MIRT1283841	hsa-miR-3913-5p	CLIP-seq
MIRT1283842	hsa-miR-4712-5p	CLIP-seq
MIRT1283843	hsa-miR-4728-5p	CLIP-seq
MIRT1283844	hsa-miR-770-5p	CLIP-seq
MIRT1921812	hsa-miR-3682-5p	CLIP-seq
MIRT1921813	hsa-miR-4691-5p	CLIP-seq
MIRT1921814	hsa-miR-4778-3p	CLIP-seq
MIRT1921812	hsa-miR-3682-5p	CLIP-seq
MIRT1921813	hsa-miR-4691-5p	CLIP-seq
MIRT1921814	hsa-miR-4778-3p	CLIP-seq
MIRT1283797	hsa-miR-10a	CLIP-seq
MIRT1283798	hsa-miR-10b	CLIP-seq
MIRT2084178	hsa-miR-1273	CLIP-seq
MIRT2084179	hsa-miR-1283	CLIP-seq
MIRT2084180	hsa-miR-217	CLIP-seq
MIRT1283838	hsa-miR-3122	CLIP-seq
MIRT2084181	hsa-miR-3613-3p	CLIP-seq
MIRT2084182	hsa-miR-3618	CLIP-seq
MIRT1283839	hsa-miR-3689a-3p	CLIP-seq
MIRT1283840	hsa-miR-3689c	CLIP-seq
MIRT1283841	hsa-miR-3913-5p	CLIP-seq
MIRT1283824	hsa-miR-4418	CLIP-seq
MIRT2084183	hsa-miR-4486	CLIP-seq
MIRT2084184	hsa-miR-4649-5p	CLIP-seq
MIRT1283808	hsa-miR-4711-3p	CLIP-seq
MIRT1283829	hsa-miR-509-3-5p	CLIP-seq
MIRT1283830	hsa-miR-509-5p	CLIP-seq
MIRT2084185	hsa-miR-5096	CLIP-seq
MIRT2084186	hsa-miR-513b	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq
MIRT2084187	hsa-miR-934	CLIP-seq
MIRT1283800	hsa-miR-1285	CLIP-seq
MIRT1283802	hsa-miR-3187-5p	CLIP-seq
MIRT1283813	hsa-miR-3664-3p	CLIP-seq
MIRT2309422	hsa-miR-3670	CLIP-seq
MIRT1283810	hsa-miR-612	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq
MIRT1283814	hsa-miR-873	CLIP-seq
MIRT1283821	hsa-miR-3622a-3p	CLIP-seq
MIRT1283822	hsa-miR-3622b-3p	CLIP-seq
MIRT1283825	hsa-miR-4505	CLIP-seq
MIRT1283827	hsa-miR-4731-5p	CLIP-seq
MIRT1283835	hsa-miR-615-5p	CLIP-seq
MIRT1283797	hsa-miR-10a	CLIP-seq
MIRT1283798	hsa-miR-10b	CLIP-seq
MIRT1283800	hsa-miR-1285	CLIP-seq
MIRT1283802	hsa-miR-3187-5p	CLIP-seq
MIRT1283808	hsa-miR-4711-3p	CLIP-seq
MIRT1283810	hsa-miR-612	CLIP-seq
MIRT1283811	hsa-miR-661	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005525	Function	GTP binding	IEA
GO:0005768	Component	Endosome	IBA	21873635
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	15308636
GO:0005794	Component	Golgi apparatus	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0015031	Process	Protein transport	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0043312	Process	Neutrophil degranulation	TAS

MIM	HGNC	e!Ensembl
609956	30268	ENSG00000172794

Protein

UniProt ID

Q96AX2

Protein name

Ras-related protein Rab-37 (EC 3.6.5.2)

Protein function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	31 → 193	Ras family	Domain

Sequence

MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFI
ATVGIDFRNKVVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDN
IRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNV
ELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSFM

Sequence length

223

Interactions

View interactions

	Reactome
			Neutrophil degranulation RAB geranylgeranylation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Renal Cell	Associate	26339402
Coronary Artery Disease	Associate	34385509
Diabetes Mellitus	Associate	23826383
Esophageal Squamous Cell Carcinoma	Associate	23372429
Fibrosis	Associate	35222428
Hypoalphalipoproteinemias	Associate	32541515
Idiopathic Pulmonary Fibrosis	Associate	35222428
Nasopharyngeal Carcinoma	Associate	32541515
Venous Thromboembolism	Associate	29117201

RAB37 (RAB37, member RAS oncogene family)