HPX (hemopexin)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3263
Gene name Gene Name - the full gene name approved by the HGNC.
Hemopexin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HPX
Synonyms (NCBI Gene) Gene synonyms aliases
HX
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1054511 hsa-miR-1297 CLIP-seq
MIRT1054512 hsa-miR-26a CLIP-seq
MIRT1054513 hsa-miR-26b CLIP-seq
MIRT1054514 hsa-miR-3185 CLIP-seq
MIRT1054515 hsa-miR-4465 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(22)
GO ID Ontology Definition Evidence Reference
GO:0002639 Process Positive regulation of immunoglobulin production IEA
GO:0002925 Process Positive regulation of humoral immune response mediated by circulating immunoglobulin IEA
GO:0005515 Function Protein binding IPI 20610401
GO:0005576 Component Extracellular region NAS 14718574
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
142290 5171 ENSG00000110169
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P02790
Protein name Hemopexin (Beta-1B-glycoprotein)
Protein function Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00045 Hemopexin 56 → 95 Hemopexin Repeat
PF00045 Hemopexin 97 → 141 Hemopexin Repeat
PF00045 Hemopexin 188 → 231 Hemopexin Repeat
PF00045 Hemopexin 263 → 306 Hemopexin Repeat
PF00045 Hemopexin 308 → 353 Hemopexin Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
Sequence 
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT
LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP
PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER
SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN
GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV
DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
Sequence length 462
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Scavenging of heme from plasma
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Autoimmune diseases Autoimmune Diseases rs869025224 18641331
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 16506275
Show/Hide Text Mining Associations (60)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 33672727
Alzheimer Disease Associate 22232349, 32517787
Anemia Sickle Cell Associate 31990387
Aortic Aneurysm Abdominal Stimulate 39192217
Arthritis Associate 30770760
Arthritis Rheumatoid Associate 34788409
Ascites Associate 27500424
beta Thalassemia Inhibit 29365317
Brain Injuries Traumatic Associate 23350672
Breast Neoplasms Stimulate 16542425