HPX (hemopexin)

Gene

• Entrez ID: 3263
• Gene name: Hemopexin
• Gene symbol: HPX
• Synonyms (NCBI Gene): HX
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1054511	hsa-miR-1297	CLIP-seq
MIRT1054512	hsa-miR-26a	CLIP-seq
MIRT1054513	hsa-miR-26b	CLIP-seq
MIRT1054514	hsa-miR-3185	CLIP-seq
MIRT1054515	hsa-miR-4465	CLIP-seq
MIRT1054516	hsa-miR-4780	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002925	Process	Positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0005515	Function	Protein binding	IPI	20610401, 28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	19433579
GO:0005615	Component	Extracellular space	TAS	3855550
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	TAS	3855550
GO:0015232	Function	Heme transmembrane transporter activity	IEA
GO:0015232	Function	Heme transmembrane transporter activity	TAS	3855550
GO:0015886	Process	Heme transport	IEA
GO:0015886	Process	Heme transport	TAS	3855550
GO:0020027	Process	Hemoglobin metabolic process	IEA
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0042168	Process	Heme metabolic process	IBA
GO:0042168	Process	Heme metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0060332	Process	Positive regulation of response to type II interferon	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IEA
GO:0060335	Process	Positive regulation of type II interferon-mediated signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 142290
• HGNC: 5171
• e!Ensembl: ENSG00000110169

Protein

• UniProt ID: P02790
• Protein name: Hemopexin (Beta-1B-glycoprotein)
• Protein function: Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00045	Hemopexin	56 → 95	Hemopexin	Repeat
  PF00045	Hemopexin	97 → 141	Hemopexin	Repeat
  PF00045	Hemopexin	188 → 231	Hemopexin	Repeat
  PF00045	Hemopexin	263 → 306	Hemopexin	Repeat
  PF00045	Hemopexin	308 → 353	Hemopexin	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.
• Sequence:

  MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT
  LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP
  PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER
  SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN
  GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
  WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV
  DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
  NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

• Sequence length: 462

Pathways

Reactome:

Scavenging of heme from plasma