APCS (amyloid P component, serum)

Gene

• Entrez ID: 325
• Gene name: Amyloid P component, serum
• Gene symbol: APCS
• Synonyms (NCBI Gene): HEL-S-92n, PTX2, SAP
• Chromosome: 1
• Chromosome location: 1q23.2
• Summary: The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene dupli

Transcription factors

Transcription factor	Regulation	Reference
TP53	Activation	15378026

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001849	Function	Complement component C1q complex binding	IBA
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001849	Function	Complement component C1q complex binding	IEA
GO:0002674	Process	Negative regulation of acute inflammatory response	IC	14607961
GO:0005509	Function	Calcium ion binding	IDA	23544079
GO:0005515	Function	Protein binding	IPI	21106539, 22396542, 32296183, 32814053
GO:0005576	Component	Extracellular region	HDA	20551380
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	14607961, 23544079
GO:0005615	Component	Extracellular space	TAS	10972085
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006457	Process	Protein folding	TAS	10812074
GO:0006953	Process	Acute-phase response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2987268
GO:0030246	Function	Carbohydrate binding	IEA
GO:0042802	Function	Identical protein binding	IPI	19372378, 22396542, 23850452
GO:0044871	Process	Negative regulation by host of viral glycoprotein metabolic process	IDA	23544079
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	23544079
GO:0045656	Process	Negative regulation of monocyte differentiation	IDA	14607961
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	23544079
GO:0046790	Function	Virion binding	IDA	23544079
GO:0046872	Function	Metal ion binding	IEA
GO:0048525	Process	Negative regulation of viral process	IDA	23544079
GO:0051082	Function	Unfolded protein binding	TAS	10812074
GO:0051131	Process	Chaperone-mediated protein complex assembly	TAS	10972085
GO:0061045	Process	Negative regulation of wound healing	IC	14607961
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1903019	Process	Negative regulation of glycoprotein metabolic process	IDA	23544079

Other IDs

• MIM: 104770
• HGNC: 584
• e!Ensembl: ENSG00000132703

Protein

• UniProt ID: P02743
• Protein name: Serum amyloid P-component (SAP) (9.5S alpha-1-glycoprotein) [Cleaved into: Serum amyloid P-component(1-203)]
• Protein function: Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin.
• PDB: 1GYK, 1LGN, 1SAC, 2A3W, 2A3X, 2A3Y, 2W08, 3D5O, 3KQR, 4AVS, 4AVT, 4AVV, 4AYU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00354	Pentaxin	26 → 219	Pentaxin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Found in serum and urine. {ECO:0000269|PubMed:15174148}.
• Sequence:

  MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
  DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESS
  SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD
  SVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV

• Sequence length: 223

Pathways

Reactome:

Amyloid fiber formation