Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3248
Gene name Gene Name - the full gene name approved by the HGNC.	15-hydroxyprostaglandin dehydrogenase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HPGD
Synonyms (NCBI Gene) Gene synonyms aliases	15-PGDH, PGDH, PGDH1, PHOAR1, SDR36C1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflamma

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434480	C>G	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs121434481	A>G	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant, intron variant
rs375335006	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant, intron variant, genic downstream transcript variant
rs587776676	GGTCTACAAC>TG	Pathogenic	Intron variant, frameshift variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs587777719	AG>-	Pathogenic	Intron variant, frameshift variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053173	hsa-miR-21-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	24699315
MIRT719015	hsa-miR-664a-3p	HITS-CLIP	19536157
MIRT719014	hsa-miR-4289	HITS-CLIP	19536157
MIRT719013	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT719012	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT719011	hsa-miR-587	HITS-CLIP	19536157
MIRT719015	hsa-miR-664a-3p	HITS-CLIP	19536157
MIRT719014	hsa-miR-4289	HITS-CLIP	19536157
MIRT719013	hsa-miR-486-5p	HITS-CLIP	19536157
MIRT719012	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT719011	hsa-miR-587	HITS-CLIP	19536157
MIRT755926	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, in vitro cullelar assays, RNA pull down assay	35317779
MIRT1054125	hsa-miR-151-3p	CLIP-seq
MIRT1054126	hsa-miR-186	CLIP-seq
MIRT1054127	hsa-miR-216a	CLIP-seq
MIRT1054128	hsa-miR-3133	CLIP-seq
MIRT1054129	hsa-miR-3154	CLIP-seq
MIRT1054130	hsa-miR-3185	CLIP-seq
MIRT1054131	hsa-miR-342-3p	CLIP-seq
MIRT1054132	hsa-miR-3647-3p	CLIP-seq
MIRT1054133	hsa-miR-3662	CLIP-seq
MIRT1054134	hsa-miR-3688-3p	CLIP-seq
MIRT1054135	hsa-miR-3978	CLIP-seq
MIRT1054136	hsa-miR-4717-3p	CLIP-seq
MIRT1054137	hsa-miR-4802-3p	CLIP-seq
MIRT1054138	hsa-miR-502-5p	CLIP-seq
MIRT1054139	hsa-miR-548ag	CLIP-seq
MIRT1054140	hsa-miR-548ai	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CREB1	Unknown	10650939
ERG	Unknown	21178489
ETS1	Unknown	10650939
NFIL3	Unknown	1620116
SNAI2	Repression	17575121

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IDA	10198228
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	NAS	15581601
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IBA
GO:0006693	Process	Prostaglandin metabolic process	IDA	16828555, 21072165
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	15574495
GO:0007565	Process	Female pregnancy	IBA
GO:0007565	Process	Female pregnancy	IDA	15531523
GO:0007565	Process	Female pregnancy	IEA
GO:0007567	Process	Parturition	IDA	15531523
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016404	Function	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IBA
GO:0016404	Function	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	2025296, 10198228, 15581601, 16828555, 21072165
GO:0016404	Function	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IEA
GO:0016404	Function	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IMP	8086429
GO:0016404	Function	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	NAS	7557451
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IDA	16757471
GO:0019372	Process	Lipoxygenase pathway	TAS	15581601
GO:0030728	Process	Ovulation	ISS
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21072165
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045786	Process	Negative regulation of cell cycle	IDA	15574495
GO:0051287	Function	NAD binding	IDA	10198228, 15581601
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070403	Function	NAD+ binding	IDA	16828555, 21072165
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070493	Process	Thrombin-activated receptor signaling pathway	ISS
GO:0097070	Process	Ductus arteriosus closure	IEA
GO:0097070	Process	Ductus arteriosus closure	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1905828	Process	Regulation of prostaglandin catabolic process	IMP	8086429

MIM	HGNC	e!Ensembl
601688	5154	ENSG00000164120

Protein

UniProt ID

P15428

Protein name

15-hydroxyprostaglandin dehydrogenase [NAD(+)] (15-PGDH) (EC 1.1.1.141) (Eicosanoid/docosanoid dehydrogenase [NAD(+)]) (EC 1.1.1.-, EC 1.1.1.232) (Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)

Protein function

Catalyzes the NAD-dependent dehydrogenation (oxidation) of a broad array of hydroxylated polyunsaturated fatty acids (mainly eicosanoids and docosanoids, including prostaglandins, lipoxins and resolvins), yielding their corresponding keto (oxo)

PDB

2GDZ , 8CVN , 8CWL , 8FD8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	6 → 199	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in colon epithelium (at protein level). {ECO:0000269|PubMed:15574495}.

Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF
IQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA
ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFQAKTQ

Sequence length

266

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Transcriptional misregulation in cancer		Synthesis of Lipoxins (LX) Biosynthesis of D-series resolvins Biosynthesis of E-series 18(S)-resolvins

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hypertrophic Osteoarthropathy	hypertrophic osteoarthropathy, primary, autosomal recessive, 1	rs121434480, rs587776676, rs548208942, rs577045722, rs587777719, rs375335006	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Colorectal Cancer	Early onset colorectal cancer, Colorectal cancer	N/A	N/A	GWAS
Cranioosteoarthropathy	cranio-osteoarthropathy	N/A	N/A	GenCC
Pachydermoperiostosis Syndrome	pachydermoperiostosis	N/A	N/A	GenCC

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	25735395, 26683690, 30531928
Adenoma	Inhibit	23960441
Adenoma	Associate	29769213
Arteriovenous Fistula	Associate	40597829
Arthritis Rheumatoid	Inhibit	26082314
Breast Neoplasms	Associate	25003827, 28206964, 35617355, 36077333
Carcinogenesis	Associate	20635443, 27561985, 30531928, 40095474
Carcinogenesis	Inhibit	23960441
Carcinoma Intraductal Noninfiltrating	Associate	19393583
Carcinoma Squamous Cell	Inhibit	25735395
Cell Transformation Neoplastic	Associate	27561985
Charcot Marie Tooth disease Type 1C	Associate	26057882
Cholangiocarcinoma	Associate	34880125
Cholangiocarcinoma	Inhibit	34880125
Chorioamnionitis	Inhibit	25048443
Clubfoot	Associate	24838973
Colonic Neoplasms	Associate	24838973, 30931980
Colorectal Neoplasms	Inhibit	15574495, 23960441, 24760190
Colorectal Neoplasms	Associate	20635443, 24694755, 30931980
Diabetic Nephropathies	Associate	40597829
Endometrial Neoplasms	Associate	31692912
Esophageal Neoplasms	Associate	25735395
Esophageal Squamous Cell Carcinoma	Associate	12901795, 25735395
Glomerulonephritis IGA	Associate	36793719
Head and Neck Neoplasms	Associate	27561985
Hereditary Breast and Ovarian Cancer Syndrome	Associate	25389781
Hypertension Pulmonary	Associate	37055764
Hypoxia	Inhibit	37055764
Inflammation	Associate	40597829
Labor Pain	Associate	29249255
Lung Neoplasms	Inhibit	19820419
Lymphatic Metastasis	Stimulate	25704623
Mesothelioma	Associate	27605433
Nail Diseases	Associate	19568269
Nail dysplasia isolated congenital	Associate	36833358
Neoplasm Invasiveness	Associate	19393583
Neoplasm Metastasis	Associate	25704623
Neoplasms	Inhibit	15574495, 19820419, 20093479, 20643784, 25735395, 28922414, 35054980, 35422093, 40095474
Neoplasms	Associate	20635443, 21281786, 23960441, 27605433, 33081378
Nose Diseases	Associate	33905579
Obesity	Inhibit	28206964
Osteoarthropathy Primary Hypertrophic	Associate	24838973, 27134495, 28851954, 33550138, 33852188, 35813463, 37591693, 39607761, 40251683
Osteoarthropathy Primary Hypertrophic	Stimulate	28425581
Ovarian Diseases	Associate	37033258
Pancreatic Neoplasms	Associate	19820419
Peeling Skin Syndrome	Inhibit	25048443
Periodontitis	Associate	36793719
Poroma	Associate	19383289, 23945349, 25389781
Prostatic Neoplasms	Associate	21281786, 33107155
Squamous Cell Carcinoma of Head and Neck	Associate	18254958, 27561985
Stomach Neoplasms	Associate	25704623, 26261578, 30531928, 33081378
Triple Negative Breast Neoplasms	Associate	36077333
Urinary Bladder Neoplasms	Associate	18308117
Urinary Bladder Neoplasms	Inhibit	20093479
Uterine Cervical Neoplasms	Associate	40095474

HPGD (15-hydroxyprostaglandin dehydrogenase)