HOXD12 (homeobox D12)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3238
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD12
Synonyms (NCBI Gene) Gene synonyms aliases
HOX4H
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(84)
miRTarBase ID miRNA Experiments Reference
MIRT635171 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT635170 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT635169 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT635168 hsa-miR-495-3p HITS-CLIP 23824327
MIRT635167 hsa-miR-5688 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001501 Process Skeletal system development IEA
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
142988 5135 ENSG00000170178
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P35452
Protein name Homeobox protein Hox-D12 (Homeobox protein Hox-4H)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 203 → 259 Homeodomain Domain
Sequence 
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCAP
AQPAGATAFGGFSQPYLAGSGPLGLQPPTAKDGPEEQAKFYAPEAAAGPEERGRTRPSFA
PESSLAPAVAALKAAKYDYAGVGRATPGSTTLLQGAPCAPGFKDDTKGPLNLNMTVQAAG
VASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLN
LSDQQVKIWFQNRRMKKKRVVLREQALALY
Sequence length 270
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 16778180
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Anorectal Malformations Associate 23127126
Celiac Disease Associate 27836013
Glioma Associate 18404365
Nystagmus Pathologic Associate 21654727
Oligodendroglioma Associate 39259414
Ovarian Neoplasms Stimulate 36213580
Syndactyly Associate 21654727