Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3237
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD11
Synonyms (NCBI Gene) Gene synonyms aliases
HOX4, HOX4F
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051956 hsa-let-7b-5p CLASH 23622248
MIRT037516 hsa-miR-744-5p CLASH 23622248
MIRT616275 hsa-miR-4706 HITS-CLIP 23824327
MIRT616276 hsa-miR-4749-5p HITS-CLIP 23824327
MIRT037516 hsa-miR-744-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001658 Process Branching involved in ureteric bud morphogenesis ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142986 5134 ENSG00000128713
Protein
UniProt ID P31277
Protein name Homeobox protein Hox-D11 (Homeobox protein Hox-4F)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12045 DUF3528 26 80 Protein of unknown function (DUF3528) Family
PF12045 DUF3528 105 194 Protein of unknown function (DUF3528) Family
PF00046 Homeodomain 267 323 Homeodomain Domain
Sequence
MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVRE
VAFRDYGLERAKWPYRGGGG
GGSAGGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAA
EEAAMQRELLPPAGRRPDVLFKAPEPVCAAPGPPHGPAGAASNFYSAVGRNGILPQGFDQ
FYEAAPGPPFAGPQ
PPPPPAPPQPEGAADKGDPRTGAGGGGGSPCTKATPGSEPKGAAEG
SGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLS
RMLNLTDRQVKIWFQNRRMKEKK
LNRDRLQYFTGNPLF
Sequence length 338
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
19540081
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
15818620
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
15818620
Carcinoma of the head and neck Squamous cell carcinoma of the head and neck rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001
View all (7 more)
22227861
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Squamous Cell Associate 36151071
Head and Neck Neoplasms Associate 25301728
Hemangioblastoma Associate 26768750
Leukemia Myelomonocytic Acute Associate 12542486
Lung Neoplasms Associate 30867848
Lymphatic Metastasis Associate 27658780
Neoplasm Metastasis Associate 36151071
Neoplasms Associate 22227861, 27658780, 27701467, 31698611
Neoplasms Stimulate 36151071
Neuroblastoma Associate 31698611