Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3236
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD10
Synonyms (NCBI Gene) Gene synonyms aliases
HOX4, HOX4D, HOX4E, Hox-4.4
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcriptio
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893634 T>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002021 hsa-miR-10b-5p Luciferase reporter assay, Western blot 17898713
MIRT002021 hsa-miR-10b-5p Luciferase reporter assay, Western blot 17898713
MIRT002021 hsa-miR-10b-5p Review 19935707
MIRT002021 hsa-miR-10b-5p Luciferase reporter assay 17898713
MIRT002021 hsa-miR-10b-5p Luciferase reporter assay, Western blot 21419107
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142984 5133 ENSG00000128710
Protein
UniProt ID P28358
Protein name Homeobox protein Hox-D10 (Homeobox protein Hox-4D) (Homeobox protein Hox-4E)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 267 323 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in the adult male and female urogenital tracts.
Sequence
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
NPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKK
MSRENRIRELTANLTFS
Sequence length 340
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Proteoglycans in cancer
MicroRNAs in cancer
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder), AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)
24529757
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Carcinoma of the head and neck Squamous cell carcinoma of the head and neck rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001
View all (7 more)
22227861
Charcot-marie-tooth disease Charcot-Marie-Tooth Disease, Charcot-Marie-Tooth Disease, Type Ia (disorder), Charcot-Marie-Tooth Disease, Type Ib rs137852739, rs137852737, rs118203972, rs118203974, rs267607183, rs267606878, rs121908287, rs1562648373, rs121908288, rs1368013631, rs28940291, rs28940292, rs28940293, rs28940294, rs28940295
View all (1137 more)
15146389
Unknown
Disease term Disease name Evidence References Source
Vertical Talus congenital vertical talus GenCC
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
ATR X syndrome Associate 37812190
Breast Neoplasms Associate 18922890, 20843787, 24386080, 25081374
Breast Neoplasms Male Associate 19664288
Carcinogenesis Associate 23980595, 26260613, 9773404
Carcinoma Ductal Breast Associate 25081374
Carcinoma Hepatocellular Associate 25236186, 34761603, 34911488
Carcinoma Renal Cell Inhibit 34825321
Charcot Marie Tooth Disease Associate 15146389, 16450407
Cholangiocarcinoma Associate 26260613
Colonic Neoplasms Stimulate 23980595