Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3235
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD9
Synonyms (NCBI Gene) Gene synonyms aliases
HOX4, HOX4C, Hox-4.3, Hox-5.2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT724683 hsa-miR-3614-5p HITS-CLIP 19536157
MIRT724682 hsa-miR-29b-2-5p HITS-CLIP 19536157
MIRT715096 hsa-miR-3156-5p HITS-CLIP 19536157
MIRT715095 hsa-miR-361-3p HITS-CLIP 19536157
MIRT715094 hsa-miR-6728-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
HOXD9 Activation 7926763
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 1756725
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 1756725
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142982 5140 ENSG00000128709
Protein
UniProt ID P28356
Protein name Homeobox protein Hox-D9 (Homeobox protein Hox-4C) (Homeobox protein Hox-5.2)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04617 Hox9_act 11 133 Family
PF00046 Homeodomain 286 342 Homeodomain Domain
Sequence
MLGGSAGRLKMSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGAQGRPAGVADGPAATA
AEFASCSFAPRSAVFSASWSAVPSQPPAAAAMSGLYHPYVPPPPLAASASEPGRYVRSWM
EPLPGFPGGAGGG
GGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSS
STSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAAATGGTGPGAGIGAATGTGGSS
EPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLEL
EKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKK
MSKEKCPKGD
Sequence length 352
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
26075790
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
26075790
Ovarian cancer Malignant neoplasm of ovary rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828
View all (31 more)
26075790
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 21600039
Biliary Tract Diseases Associate 30832707
Breast Neoplasms Associate 33428601, 34452548
Carcinoma Hepatocellular Associate 30247807, 34116652, 34911488, 35030478, 36397165
Carcinoma Non Small Cell Lung Associate 36907878
Carcinoma Ovarian Epithelial Associate 26391404
Cholangiocarcinoma Associate 24089088, 30832707
Colorectal Neoplasms Associate 26075790
Developmental Dysplasia of the Hip Associate 22520331
Diabetic Nephropathies Associate 39511608