Gene Gene information from NCBI Gene database.
Entrez ID 3233
Gene name Homeobox D4
Gene symbol HOXD4
Synonyms (NCBI Gene)
HHO.C13HOX-5.1HOX4HOX4BHox-4.2
Chromosome 2
Chromosome location 2q31.1
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
27
miRTarBase ID miRNA Experiments Reference
MIRT623680 hsa-miR-6835-3p HITS-CLIP 23824327
MIRT623679 hsa-miR-451b HITS-CLIP 23824327
MIRT648193 hsa-miR-6734-3p HITS-CLIP 23824327
MIRT623678 hsa-miR-302a-5p HITS-CLIP 23824327
MIRT623677 hsa-miR-4326 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP 1756725
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142981 5138 ENSG00000170166
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P09016
Protein name Homeobox protein Hox-D4 (Homeobox protein HHO.C13) (Homeobox protein Hox-4B) (Homeobox protein Hox-5.1)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 155 211 Homeodomain Domain
Sequence
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQ
PFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQ
PPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLT
RRRRIEIAHTLCLSERQIKIWFQNRRMKWKK
DHKLPNTKGRSSSSSSSSSCSSSVAPSQH
LQPMAKDHHTDLTTL
Sequence length 255
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Leukemia, acute lymphoblastic, susceptibility to Uncertain significance rs104893636 RCV000016017
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arachnoid Cysts Associate 26545093
Breast Neoplasms Associate 19232136
Carcinoma Hepatocellular Associate 22976466
Carcinoma Renal Cell Associate 37827698
Lymphatic Metastasis Stimulate 30588951
Neoplasms Associate 30588951, 36213580, 37827698
Neuroblastoma Associate 7501971
Neurofibroma Associate 32366326
Ovarian Neoplasms Associate 36213580
Plaque Atherosclerotic Associate 25856389