Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3233
Gene name Gene Name - the full gene name approved by the HGNC.	Homeobox D4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOXD4
Synonyms (NCBI Gene) Gene synonyms aliases	HHO.C13, HOX-5.1, HOX4, HOX4B, Hox-4.2
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT648193	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT648193	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT1053796	hsa-miR-542-3p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	1756725
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	1756725
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	1756725
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0030054	Component	Cell junction	IDA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1756725
GO:0048568	Process	Embryonic organ development	IEP	2879245
GO:0048704	Process	Embryonic skeletal system morphogenesis	IBA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142981	5138	ENSG00000170166

Protein

UniProt ID

P09016

Protein name

Homeobox protein Hox-D4 (Homeobox protein HHO.C13) (Homeobox protein Hox-4B) (Homeobox protein Hox-5.1)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	155 → 211	Homeodomain	Domain

Sequence

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQ
PFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQ
PPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLT
RRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQH
LQPMAKDHHTDLTTL

Sequence length

255

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lymphoblastic Leukemia	Leukemia, acute lymphoblastic, susceptibility to	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arachnoid Cysts	Associate	26545093
Breast Neoplasms	Associate	19232136
Carcinoma Hepatocellular	Associate	22976466
Carcinoma Renal Cell	Associate	37827698
Lymphatic Metastasis	Stimulate	30588951
Neoplasms	Associate	30588951, 36213580, 37827698
Neuroblastoma	Associate	7501971
Neurofibroma	Associate	32366326
Ovarian Neoplasms	Associate	36213580
Plaque Atherosclerotic	Associate	25856389
Stomach Neoplasms	Associate	21562367, 30588951
Testicular Germ Cell Tumor	Inhibit	37827698

HOXD4 (homeobox D4)