Gene Gene information from NCBI Gene database.
Entrez ID 3231
Gene name Homeobox D1
Gene symbol HOXD1
Synonyms (NCBI Gene)
HOX4HOX4GHox-4.7
Chromosome 2
Chromosome location 2q31.1
Summary This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in t
miRNA miRNA information provided by mirtarbase database.
48
miRTarBase ID miRNA Experiments Reference
MIRT536762 hsa-miR-125b-5p PAR-CLIP 22012620
MIRT536761 hsa-miR-125a-5p PAR-CLIP 22012620
MIRT536760 hsa-miR-4319 PAR-CLIP 22012620
MIRT536759 hsa-miR-3617-5p PAR-CLIP 22012620
MIRT536758 hsa-miR-641 PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142987 5132 ENSG00000128645
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GZZ0
Protein name Homeobox protein Hox-D1 (Homeobox protein Hox-GG)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 231 286 Homeodomain Domain
Sequence
MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAAR
PSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGV
LGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQT
ASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKK
REREGLLATAIPVA
PLQLPLSGTTPTKFIKNPGSPSQSQEPS
Sequence length 328
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Signaling pathways regulating pluripotency of stem cells