Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3231
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD1
Synonyms (NCBI Gene) Gene synonyms aliases
HOX4, HOX4G, Hox-4.7
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT536762 hsa-miR-125b-5p PAR-CLIP 22012620
MIRT536761 hsa-miR-125a-5p PAR-CLIP 22012620
MIRT536760 hsa-miR-4319 PAR-CLIP 22012620
MIRT536759 hsa-miR-3617-5p PAR-CLIP 22012620
MIRT536758 hsa-miR-641 PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142987 5132 ENSG00000128645
Protein
UniProt ID Q9GZZ0
Protein name Homeobox protein Hox-D1 (Homeobox protein Hox-GG)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 231 286 Homeodomain Domain
Sequence
MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAAR
PSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGV
LGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQT
ASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKK
REREGLLATAIPVA
PLQLPLSGTTPTKFIKNPGSPSQSQEPS
Sequence length 328
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Signaling pathways regulating pluripotency of stem cells  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22647880
Esophageal Squamous Cell Carcinoma Associate 36447287
Lymphatic Metastasis Associate 28951630
Neoplasms Associate 24236209, 28951630, 36213580, 37827698
Neoplasms Inhibit 33019382
Neuroblastoma Associate 7501971
Oligodendroglioma Associate 24236209
Osteoarthritis Knee Associate 39313491
Ovarian Neoplasms Associate 20852632
Ovarian Neoplasms Stimulate 36213580