Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3231
Gene name Gene Name - the full gene name approved by the HGNC.	Homeobox D1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOXD1
Synonyms (NCBI Gene) Gene synonyms aliases	HOX4, HOX4G, Hox-4.7
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in t

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT536762	hsa-miR-125b-5p	PAR-CLIP	22012620
MIRT536761	hsa-miR-125a-5p	PAR-CLIP	22012620
MIRT536760	hsa-miR-4319	PAR-CLIP	22012620
MIRT536759	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT536758	hsa-miR-641	PAR-CLIP	22012620
MIRT536757	hsa-miR-4719	PAR-CLIP	22012620
MIRT536756	hsa-miR-345-3p	PAR-CLIP	22012620
MIRT536755	hsa-miR-4732-3p	PAR-CLIP	22012620
MIRT536754	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT536753	hsa-miR-3161	PAR-CLIP	22012620
MIRT439158	hsa-let-7c-5p	3'LIFE	25074381
MIRT439124	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439158	hsa-let-7c-5p	3'LIFE	25074381
MIRT439124	hsa-miR-10b-5p	3'LIFE	25074381
MIRT536762	hsa-miR-125b-5p	PAR-CLIP	22012620
MIRT536761	hsa-miR-125a-5p	PAR-CLIP	22012620
MIRT536760	hsa-miR-4319	PAR-CLIP	22012620
MIRT536759	hsa-miR-3617-5p	PAR-CLIP	22012620
MIRT536758	hsa-miR-641	PAR-CLIP	22012620
MIRT536757	hsa-miR-4719	PAR-CLIP	22012620
MIRT536756	hsa-miR-345-3p	PAR-CLIP	22012620
MIRT536755	hsa-miR-4732-3p	PAR-CLIP	22012620
MIRT536754	hsa-miR-670-5p	PAR-CLIP	22012620
MIRT536753	hsa-miR-3161	PAR-CLIP	22012620
MIRT1053744	hsa-miR-1587	CLIP-seq
MIRT1053745	hsa-miR-15a	CLIP-seq
MIRT1053746	hsa-miR-15b	CLIP-seq
MIRT1053747	hsa-miR-16	CLIP-seq
MIRT1053748	hsa-miR-195	CLIP-seq
MIRT1053749	hsa-miR-3182	CLIP-seq
MIRT1053750	hsa-miR-3663-3p	CLIP-seq
MIRT1053751	hsa-miR-378g	CLIP-seq
MIRT1053752	hsa-miR-424	CLIP-seq
MIRT1053753	hsa-miR-4303	CLIP-seq
MIRT1053754	hsa-miR-4487	CLIP-seq
MIRT1053755	hsa-miR-4492	CLIP-seq
MIRT1053756	hsa-miR-4498	CLIP-seq
MIRT1053757	hsa-miR-4524	CLIP-seq
MIRT1053758	hsa-miR-4656	CLIP-seq
MIRT1053759	hsa-miR-4675	CLIP-seq
MIRT1053760	hsa-miR-4741	CLIP-seq
MIRT1053761	hsa-miR-497	CLIP-seq
MIRT1053762	hsa-miR-503	CLIP-seq
MIRT1053763	hsa-miR-512-3p	CLIP-seq
MIRT1053764	hsa-miR-646	CLIP-seq
MIRT1053765	hsa-miR-759	CLIP-seq
MIRT1053766	hsa-miR-762	CLIP-seq
MIRT1053767	hsa-miR-885-3p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142987	5132	ENSG00000128645

Protein

UniProt ID

Q9GZZ0

Protein name

Homeobox protein Hox-D1 (Homeobox protein Hox-GG)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	231 → 286	Homeodomain	Domain

Sequence

MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAAR
PSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGV
LGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQT
ASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVA
PLQLPLSGTTPTKFIKNPGSPSQSQEPS

Sequence length

328

Interactions

View interactions

	KEGG
	Signaling pathways regulating pluripotency of stem cells

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	17892325
Colorectal neoplasms	Colorectal Neoplasms	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	17892325
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)	20852632

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Kidney Disease	Kidney Disease			GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	22647880
Esophageal Squamous Cell Carcinoma	Associate	36447287
Lymphatic Metastasis	Associate	28951630
Neoplasms	Associate	24236209, 28951630, 36213580, 37827698
Neoplasms	Inhibit	33019382
Neuroblastoma	Associate	7501971
Oligodendroglioma	Associate	24236209
Osteoarthritis Knee	Associate	39313491
Ovarian Neoplasms	Associate	20852632
Ovarian Neoplasms	Stimulate	36213580
Pain	Associate	39313491
Testicular Germ Cell Tumor	Associate	37827698

HOXD1 (homeobox D1)