Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3229
Gene name Gene Name - the full gene name approved by the HGNC.	Homeobox C13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOXC13
Synonyms (NCBI Gene) Gene synonyms aliases	ECTD9, HOX3, HOX3G
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ECTD9
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004974	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR	19524507
MIRT039788	hsa-miR-615-3p	CLASH	23622248
MIRT462052	hsa-miR-548m	PAR-CLIP	23592263
MIRT462051	hsa-miR-595	PAR-CLIP	23592263
MIRT462050	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT462049	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT462048	hsa-miR-4784	PAR-CLIP	23592263
MIRT462047	hsa-miR-4316	PAR-CLIP	23592263
MIRT462046	hsa-miR-1294	PAR-CLIP	23592263
MIRT462045	hsa-miR-4689	PAR-CLIP	23592263
MIRT462044	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT462052	hsa-miR-548m	PAR-CLIP	23592263
MIRT462051	hsa-miR-595	PAR-CLIP	23592263
MIRT462050	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT462049	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT462048	hsa-miR-4784	PAR-CLIP	23592263
MIRT462047	hsa-miR-4316	PAR-CLIP	23592263
MIRT462046	hsa-miR-1294	PAR-CLIP	23592263
MIRT462045	hsa-miR-4689	PAR-CLIP	23592263
MIRT462044	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT1053590	hsa-miR-31	CLIP-seq
MIRT1053591	hsa-miR-3128	CLIP-seq
MIRT1053592	hsa-miR-339-3p	CLIP-seq
MIRT1053593	hsa-miR-4715-3p	CLIP-seq
MIRT1053594	hsa-miR-4720-5p	CLIP-seq
MIRT1053595	hsa-miR-4761-5p	CLIP-seq
MIRT1053596	hsa-miR-4792	CLIP-seq
MIRT1053597	hsa-miR-4799-3p	CLIP-seq
MIRT1053598	hsa-miR-499a-5p	CLIP-seq
MIRT2012165	hsa-miR-1224-5p	CLIP-seq
MIRT2012166	hsa-miR-1304	CLIP-seq
MIRT2012167	hsa-miR-1827	CLIP-seq
MIRT2012168	hsa-miR-296-5p	CLIP-seq
MIRT2012169	hsa-miR-29a	CLIP-seq
MIRT2012170	hsa-miR-29b	CLIP-seq
MIRT2012171	hsa-miR-29c	CLIP-seq
MIRT2012172	hsa-miR-3065-3p	CLIP-seq
MIRT2012173	hsa-miR-3202	CLIP-seq
MIRT2012174	hsa-miR-3612	CLIP-seq
MIRT2012175	hsa-miR-3915	CLIP-seq
MIRT1053593	hsa-miR-4715-3p	CLIP-seq
MIRT2012176	hsa-miR-4747-5p	CLIP-seq
MIRT1053595	hsa-miR-4761-5p	CLIP-seq
MIRT1053598	hsa-miR-499a-5p	CLIP-seq
MIRT2012177	hsa-miR-501-3p	CLIP-seq
MIRT2012178	hsa-miR-502-3p	CLIP-seq
MIRT2012179	hsa-miR-650	CLIP-seq
MIRT2012180	hsa-miR-767-5p	CLIP-seq
MIRT2244538	hsa-miR-1324	CLIP-seq
MIRT2244539	hsa-miR-3124-3p	CLIP-seq
MIRT2244540	hsa-miR-3136-5p	CLIP-seq
MIRT2244541	hsa-miR-3913-3p	CLIP-seq
MIRT2244542	hsa-miR-4439	CLIP-seq
MIRT2244543	hsa-miR-4450	CLIP-seq
MIRT2244544	hsa-miR-4667-5p	CLIP-seq
MIRT2244545	hsa-miR-4700-5p	CLIP-seq
MIRT2244546	hsa-miR-4731-3p	CLIP-seq
MIRT2244547	hsa-miR-4731-5p	CLIP-seq
MIRT2244548	hsa-miR-4801	CLIP-seq
MIRT2244549	hsa-miR-499-3p	CLIP-seq
MIRT2244550	hsa-miR-499a-3p	CLIP-seq
MIRT2244551	hsa-miR-616	CLIP-seq
MIRT2244552	hsa-miR-943	CLIP-seq
MIRT2389132	hsa-miR-3182	CLIP-seq
MIRT2389133	hsa-miR-3686	CLIP-seq
MIRT2389134	hsa-miR-3690	CLIP-seq
MIRT2389135	hsa-miR-378	CLIP-seq
MIRT2389136	hsa-miR-378b	CLIP-seq
MIRT2389137	hsa-miR-378c	CLIP-seq
MIRT2389138	hsa-miR-378d	CLIP-seq
MIRT2389139	hsa-miR-378e	CLIP-seq
MIRT2389140	hsa-miR-378f	CLIP-seq
MIRT2389141	hsa-miR-378h	CLIP-seq
MIRT2389142	hsa-miR-378i	CLIP-seq
MIRT2389143	hsa-miR-422a	CLIP-seq
MIRT2389144	hsa-miR-619	CLIP-seq
MIRT2451345	hsa-miR-185	CLIP-seq
MIRT2451346	hsa-miR-4306	CLIP-seq
MIRT2451347	hsa-miR-4644	CLIP-seq
MIRT2244546	hsa-miR-4731-3p	CLIP-seq
MIRT2244548	hsa-miR-4801	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	18692240, 25609649
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10835276
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0035878	Process	Nail development	IEA
GO:0043587	Process	Tongue morphogenesis	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142976	5125	ENSG00000123364

Protein

UniProt ID

P31276

Protein name

Homeobox protein Hox-C13 (Homeobox protein Hox-3G)

Protein function

Transcription factor which plays a role in hair follicle differentiation. Regulates FOXQ1 expression and that of other hair-specific genes (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12284	HoxA13_N	54 → 168	Hox protein A13 N terminal	Family
PF00046	Homeodomain	261 → 317	Homeodomain	Domain

Sequence

MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGL
GSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLG
YGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFAS
SYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLW
KSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLS
ERQVTIWFQNRRVKEKKVVSKSKAPHLHST

Sequence length

330

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Ectodermal dysplasia	Ectodermal Dysplasia, Ectodermal Dysplasia, Pure Hair-Nail Type, ECTODERMAL DYSPLASIA 9, HAIR/NAIL TYPE, Pure hair and nail ectodermal dysplasia	rs74315309, rs121908116, rs1558814967, rs121908450, rs121908452, rs121908453, rs797044435, rs121908454, rs121908455, rs121908456, rs797044436, rs797044437, rs137853324, rs137853325, rs137853326 View all (42 more)	23063621, 24239177, 28297138
Hypotrichosis	Hypotrichosis	rs121434306, rs121434307, rs121434308, rs121434309, rs1325804776, rs267606775, rs786200875, rs1568062215, rs267606776, rs1462595806, rs267606777, rs267606659, rs2147483647, rs559648418, rs121917819 View all (18 more)
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Biliary Atresia	Biliary Atresia			GWAS

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Alopecia Areata	Associate	35983595
Carcinoma Hepatocellular	Associate	31539123
Carcinoma Squamous Cell	Associate	37442189
Cholangiocarcinoma	Associate	31040073
Colorectal Neoplasms	Associate	30541551, 30884206, 38378070
Ectodermal Dysplasia Pure Hair Nail Type	Associate	28403827
Esophageal Squamous Cell Carcinoma	Associate	39596630
Hemangioblastoma	Associate	26768750
Hematologic Neoplasms	Associate	30347268
Leukemia	Associate	19922474
Leukemia Biphenotypic Acute	Associate	19922474
Liposarcoma	Associate	24085196
Lymphatic Metastasis	Associate	30541551
Lymphatic Metastasis	Stimulate	31539123
Melanoma	Stimulate	22583695
Neoplasm Metastasis	Associate	24189220, 31539123
Neoplasms	Associate	30541551, 38057852
Pancreatic Neoplasms	Associate	34134622
Pilomatrixoma	Associate	15140206
Prostatic Neoplasms	Associate	27966447, 38057852
Prostatic Neoplasms Castration Resistant	Associate	38057852
Squamous Cell Carcinoma of Head and Neck	Associate	24076275, 24519855, 31391008
Stomach Neoplasms	Associate	32176636
Thyroid Cancer Papillary	Associate	24189220
Uterine Cervical Neoplasms	Associate	16803519, 34564982, 36833285

HOXC13 (homeobox C13)