HOXC4 (homeobox C4)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3221
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox C4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXC4
Synonyms (NCBI Gene) Gene synonyms aliases
HOX3, HOX3E, cp19
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(193)
miRTarBase ID miRNA Experiments Reference
MIRT019246 hsa-miR-331-3p Sequencing 20371350
MIRT021293 hsa-miR-125a-5p Sequencing 20371350
MIRT022277 hsa-miR-124-3p Microarray 18668037
MIRT029035 hsa-miR-26b-5p Microarray 19088304
MIRT052528 hsa-let-7a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15252056
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
142974 5126 ENSG00000198353
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P09017
Protein name Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 157 → 213 Homeodomain Domain
Sequence 
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRP
SYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQP
APDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRY
LTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATP
GTSEDHSQSATPPEQQRAEDITRL
Sequence length 264
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Diabetes Diabetes GWAS
Hypertension Hypertension GWAS
Osteoporosis Osteoporosis GWAS
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Squamous Cell Associate 7915745
Cholangiocarcinoma Associate 39766812
Colorectal Neoplasms Associate 32957968, 37434131
Glioma Associate 28055976
Leukemia Associate 8634419
Lymphoma Associate 9327740
Lymphoma Large B Cell Diffuse Associate 9327740
Lymphoma Non Hodgkin Associate 9354682
Neurofibroma Associate 32366326
Obesity Associate 26213922