Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3221
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox C4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXC4
Synonyms (NCBI Gene) Gene synonyms aliases
HOX3, HOX3E, cp19
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019246 hsa-miR-331-3p Sequencing 20371350
MIRT021293 hsa-miR-125a-5p Sequencing 20371350
MIRT022277 hsa-miR-124-3p Microarray 18668037
MIRT029035 hsa-miR-26b-5p Microarray 19088304
MIRT052528 hsa-let-7a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15252056
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142974 5126 ENSG00000198353
Protein
UniProt ID P09017
Protein name Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 157 213 Homeodomain Domain
Sequence
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRP
SYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQP
APDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRY
LTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK
DHRLPNTKVRSAPPAGAAPSTLSAATP
GTSEDHSQSATPPEQQRAEDITRL
Sequence length 264
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hypertension Hypertension, Hypertension (confirmatory factor analysis Factor 12), High blood pressure / hypertension, Hypertension (PheCode 401), Essential hypertension (PheCode 401.1) N/A N/A GWAS
Osteoporosis Osteoporosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Squamous Cell Associate 7915745
Cholangiocarcinoma Associate 39766812
Colorectal Neoplasms Associate 32957968, 37434131
Glioma Associate 28055976
Leukemia Associate 8634419
Lymphoma Associate 9327740
Lymphoma Large B Cell Diffuse Associate 9327740
Lymphoma Non Hodgkin Associate 9354682
Neurofibroma Associate 32366326
Obesity Associate 26213922