Gene Gene information from NCBI Gene database.
Entrez ID 3221
Gene name Homeobox C4
Gene symbol HOXC4
Synonyms (NCBI Gene)
HOX3HOX3Ecp19
Chromosome 12
Chromosome location 12q13.13
Summary This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
193
miRTarBase ID miRNA Experiments Reference
MIRT019246 hsa-miR-331-3p Sequencing 20371350
MIRT021293 hsa-miR-125a-5p Sequencing 20371350
MIRT022277 hsa-miR-124-3p Microarray 18668037
MIRT029035 hsa-miR-26b-5p Microarray 19088304
MIRT052528 hsa-let-7a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15252056
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142974 5126 ENSG00000198353
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P09017
Protein name Homeobox protein Hox-C4 (Homeobox protein CP19) (Homeobox protein Hox-3E)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 157 213 Homeodomain Domain
Sequence
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRP
SYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQP
APDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRY
LTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK
DHRLPNTKVRSAPPAGAAPSTLSAATP
GTSEDHSQSATPPEQQRAEDITRL
Sequence length 264
Interactions View interactions