Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3218
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox B8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXB8
Synonyms (NCBI Gene) Gene synonyms aliases
HOX2, HOX2D, Hox-2.4
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002266 hsa-miR-196a-5p Western blot 19418581
MIRT002266 hsa-miR-196a-5p Luciferase reporter assay 18493311
MIRT001042 hsa-miR-196b-5p Luciferase reporter assay 18493311
MIRT002266 hsa-miR-196a-5p Review 20029422
MIRT001042 hsa-miR-196b-5p Review 20029422
Transcription factors
Transcription factor Regulation Reference
HOXC10 Repression 18534812
HOXC9 Repression 18534812
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142963 5119 ENSG00000120068
Protein
UniProt ID P17481
Protein name Homeobox protein Hox-B8 (Homeobox protein Hox-2.4) (Homeobox protein Hox-2D)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 147 203 Homeodomain Domain
Sequence
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHG
PSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGE
EAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVS
HALGLTERQVKIWFQNRRMKWKK
ENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKG
DKK
Sequence length 243
Interactions View interactions
<