Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3217
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox B7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXB7
Synonyms (NCBI Gene) Gene synonyms aliases
HHO.C1, HOX2, HOX2C, Hox-2.3
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcriptio
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004244 hsa-miR-196a-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 20480203
MIRT004244 hsa-miR-196a-5p Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot 20480203
MIRT030282 hsa-miR-26b-5p Microarray 19088304
MIRT438111 hsa-miR-196b-5p Luciferase reporter assay 23861821
MIRT438111 hsa-miR-196b-5p Luciferase reporter assay 23861821
Transcription factors
Transcription factor Regulation Reference
NFYA Unknown 12697323
NFYB Unknown 12697323
NFYC Unknown 12697323
SP1 Unknown 12697323
SP3 Unknown 12697323
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 8756643
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142962 5118 ENSG00000260027
Protein
UniProt ID P09629
Protein name Homeobox protein Hox-B7 (Homeobox protein HHO.C1) (Homeobox protein Hox-2C)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 138 194 Homeodomain Domain
Sequence
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKK
ENKTAGPGTTGQDRAEAEEEEEE
Sequence length 217
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypertension Hypertensive disease rs13306026 27618447
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 30670912
Adenocarcinoma of Lung Associate 38594917
Anophthalmia with pulmonary hypoplasia Stimulate 24641834
Barrett Esophagus Stimulate 22603795
Barrett Esophagus Associate 30670912
Breast Neoplasms Associate 10435624, 26014856, 26135503, 34680970
Carcinogenesis Associate 26307396, 33977077
Carcinoma Hepatocellular Associate 28454092
Carcinoma Pancreatic Ductal Stimulate 22914903
Carcinoma Pancreatic Ductal Associate 24088503, 24641834, 25183455