Gene Gene information from NCBI Gene database.
Entrez ID 3217
Gene name Homeobox B7
Gene symbol HOXB7
Synonyms (NCBI Gene)
HHO.C1HOX2HOX2CHox-2.3
Chromosome 17
Chromosome location 17q21.32
Summary This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcriptio
miRNA miRNA information provided by mirtarbase database.
151
miRTarBase ID miRNA Experiments Reference
MIRT004244 hsa-miR-196a-5p ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot 20480203
MIRT004244 hsa-miR-196a-5p ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot 20480203
MIRT030282 hsa-miR-26b-5p Microarray 19088304
MIRT438111 hsa-miR-196b-5p Luciferase reporter assay 23861821
MIRT438111 hsa-miR-196b-5p Luciferase reporter assay 23861821
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
NFYA Unknown 12697323
NFYB Unknown 12697323
NFYC Unknown 12697323
SP1 Unknown 12697323
SP3 Unknown 12697323
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 8756643
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142962 5118 ENSG00000260027
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P09629
Protein name Homeobox protein Hox-B7 (Homeobox protein HHO.C1) (Homeobox protein Hox-2C)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 138 194 Homeodomain Domain
Sequence
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKK
ENKTAGPGTTGQDRAEAEEEEEE
Sequence length 217
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPERTENSION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 30670912
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Associate 38594917
★☆☆☆☆
Found in Text Mining only
Anophthalmia with pulmonary hypoplasia Stimulate 24641834
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Stimulate 22603795
★☆☆☆☆
Found in Text Mining only
Barrett Esophagus Associate 30670912
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 10435624, 26014856, 26135503, 34680970
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 26307396, 33977077
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 28454092
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Stimulate 22914903
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Associate 24088503, 24641834, 25183455
★☆☆☆☆
Found in Text Mining only