Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3213
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox B3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXB3
Synonyms (NCBI Gene) Gene synonyms aliases
HOX2, HOX2G, Hox-2.7
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006838 hsa-miR-7-5p Luciferase reporter assay 22705304
MIRT006839 hsa-miR-218-5p Luciferase reporter assay 22705304
MIRT025627 hsa-miR-10a-5p Sequencing 20371350
MIRT557091 hsa-miR-124-3p PAR-CLIP 21572407
MIRT557090 hsa-miR-4695-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 7913891
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142966 5114 ENSG00000120093
Protein
UniProt ID P14651
Protein name Homeobox protein Hox-B3 (Homeobox protein Hox-2.7) (Homeobox protein Hox-2G)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 189 245 Homeodomain Domain
PF13293 DUF4074 365 429 Domain of unknown function (DUF4074) Family
Sequence
MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNA
APHAKSKELNGSCMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPG
TNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDK
SPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRR
MKYKK
DQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYESPSPPAFGKAHQN
AYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYAD
PLPPPAGPSLYGLNHLSHHPSGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQG
RIQEAPKLT
HL
Sequence length 431
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)
22484627
Unknown
Disease term Disease name Evidence References Source
Hypertension Hypertension GWAS
Motion Sickness Motion Sickness GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27782156
Carcinoma Hepatocellular Associate 35127344
Carcinoma Ovarian Epithelial Associate 30559148
Death Associate 36973255
Graves Ophthalmopathy Associate 29214313
Leukemia Monocytic Acute Associate 10765922
Leukemia Myeloid Acute Associate 25996682
Leukemia Myeloid Acute Stimulate 38254070
Myelodysplastic Syndromes Associate 38254070
Neoplasm Metastasis Inhibit 32673827