Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3206
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox A10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXA10
Synonyms (NCBI Gene) Gene synonyms aliases
HOX1, HOX1.8, HOX1H, PL
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000190 hsa-miR-204-5p Review 20029422
MIRT004850 hsa-miR-192-5p Luciferase reporter assay, qRT-PCR 19074876
MIRT000190 hsa-miR-204-5p Microarray, Western blot 18308931
MIRT005441 hsa-miR-130a-3p Luciferase reporter assay, Microarray, qRT-PCR 20981674
MIRT006793 hsa-miR-135a-5p Luciferase reporter assay 22439757
Transcription factors
Transcription factor Regulation Reference
CREBBP Activation 16849538
GZF1 Repression 16049025
HOXA11 Repression 17688409
VDR Activation 15905361
WT1 Unknown 23888944
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 21471217
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142957 5100 ENSG00000253293
Protein
UniProt ID P31260
Protein name Homeobox protein Hox-A10 (Homeobox protein Hox-1.8) (Homeobox protein Hox-1H) (PL)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 337 393 Homeodomain Domain
Sequence
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK
MNRENRIRELTANFNFS
Sequence length 410
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Transcriptional misregulation in cancer  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 21670700
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 21670700
Endometrial carcinoma Endometrial Carcinoma rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077
View all (247 more)
21670700
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Inhibit 27793380
Adenocarcinoma Associate 21670700
Adenoma Islet Cell Stimulate 30575306
Adenomyosis Associate 21067721
Adenomyosis Inhibit 30687738
Breast Neoplasms Associate 15044858, 22037257, 22439757, 27993161, 28748001
Breast Neoplasms Inhibit 9528762
Calcinosis Cutis Associate 35806108
Carcinogenesis Associate 23815210, 26097543, 37432996
Carcinoma Hepatocellular Associate 25120782, 33634306