Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID	3204
Gene name	Homeobox A7
Gene symbol	HOXA7
Synonyms (NCBI Gene)	ANTPHOX1HOX1.1HOX1A
Chromosome	7
Chromosome location	7p15.2
Summary	In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002940	hsa-miR-196a-5p	Western blot	19418581
MIRT002940	hsa-miR-196a-5p	Review	20029422
MIRT004640	hsa-miR-196b-5p	Review	20029422
MIRT002940	hsa-miR-196a-5p	Luciferase reporter assay	15105502
MIRT002940	hsa-miR-196a-5p	Sequencing	20371350
MIRT049904	hsa-miR-31-5p	CLASH	23622248
MIRT002940	hsa-miR-196a-5p	CLASH	23622248
MIRT038144	hsa-miR-423-5p	CLASH	23622248
MIRT438330	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT438330	hsa-miR-142-3p	Luciferase reporter assay	24057258
MIRT1053261	hsa-miR-101	CLIP-seq
MIRT1053262	hsa-miR-144	CLIP-seq
MIRT1053263	hsa-miR-3671	CLIP-seq
MIRT1053264	hsa-miR-4261	CLIP-seq
MIRT1053265	hsa-miR-4496	CLIP-seq
MIRT1053266	hsa-miR-4686	CLIP-seq
MIRT1053267	hsa-miR-548aa	CLIP-seq
MIRT1053268	hsa-miR-548c-3p	CLIP-seq
MIRT1053269	hsa-miR-607	CLIP-seq
MIRT2012124	hsa-miR-1266	CLIP-seq
MIRT2012125	hsa-miR-320a	CLIP-seq
MIRT2012126	hsa-miR-320b	CLIP-seq
MIRT2012127	hsa-miR-320c	CLIP-seq
MIRT2012128	hsa-miR-320d	CLIP-seq
MIRT2012129	hsa-miR-3689a-3p	CLIP-seq
MIRT2012130	hsa-miR-3689c	CLIP-seq
MIRT2012131	hsa-miR-4270	CLIP-seq
MIRT2012132	hsa-miR-4429	CLIP-seq
MIRT2012133	hsa-miR-4441	CLIP-seq
MIRT2012134	hsa-miR-4518	CLIP-seq
MIRT2244368	hsa-miR-199a-5p	CLIP-seq
MIRT2244369	hsa-miR-199b-5p	CLIP-seq
MIRT2244370	hsa-miR-3147	CLIP-seq
MIRT2244371	hsa-miR-376c	CLIP-seq
MIRT2244372	hsa-miR-4425	CLIP-seq
MIRT2244373	hsa-miR-450b-3p	CLIP-seq
MIRT2244374	hsa-miR-4646-5p	CLIP-seq
MIRT2244375	hsa-miR-769-3p	CLIP-seq
MIRT2451318	hsa-miR-1275	CLIP-seq
MIRT2451319	hsa-miR-3170	CLIP-seq
MIRT2451320	hsa-miR-3176	CLIP-seq
MIRT2451321	hsa-miR-3922-3p	CLIP-seq
MIRT2451322	hsa-miR-4665-5p	CLIP-seq
MIRT2451323	hsa-miR-661	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
PCGF2	Activation	22085718
PCGF2	Repression	22085718

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11435435
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11435435, 14704364
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11435435
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11435435
GO:0001525	Process	Angiogenesis	IEP	17972163
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IDA	14704364
GO:0002686	Process	Negative regulation of leukocyte migration	IDA	14704364
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	11435435
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	11435435
GO:0045617	Process	Negative regulation of keratinocyte differentiation	IDA	11435435
GO:0045656	Process	Negative regulation of monocyte differentiation	IDA	14704364
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11435435
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11435435
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	18973687
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142950	5108	ENSG00000122592

P31268

Protein name

Homeobox protein Hox-A7 (Homeobox protein Hox 1.1) (Homeobox protein Hox-1A)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	131 → 187	Homeodomain	Domain

Sequence

MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY
PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN
RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE

Sequence length

230

Interactions

View interactions

HOXA7 (homeobox A7)