Gene Gene information from NCBI Gene database.
Entrez ID 3202
Gene name Homeobox A5
Gene symbol HOXA5
Synonyms (NCBI Gene)
HOX1HOX1.3HOX1C
Chromosome 7
Chromosome location 7p15.2
Summary In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
miRNA miRNA information provided by mirtarbase database.
197
miRTarBase ID miRNA Experiments Reference
MIRT000958 hsa-miR-130a-3p Luciferase reporter assayqRT-PCRWestern blotNorthern blot 17957028
MIRT000958 hsa-miR-130a-3p Review 19935707
MIRT001794 hsa-miR-19a-3p Luciferase reporter assay 14697198
MIRT006906 hsa-miR-196a-5p Luciferase reporter assayqRT-PCRWestern blot 22876840
MIRT016043 hsa-miR-374b-5p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10879542
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
142952 5106 ENSG00000106004
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20719
Protein name Homeobox protein Hox-A5 (Homeobox protein Hox-1C)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 196 252 Homeodomain Domain
Sequence
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG
SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKN
SLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKK
DNKLKSMSMAAAGGAFRP
Sequence length 270
Interactions View interactions