Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3202
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXA5
Synonyms (NCBI Gene) Gene synonyms aliases
HOX1, HOX1.3, HOX1C
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000958 hsa-miR-130a-3p Luciferase reporter assay, qRT-PCR, Western blot, Northern blot 17957028
MIRT000958 hsa-miR-130a-3p Review 19935707
MIRT001794 hsa-miR-19a-3p Luciferase reporter assay 14697198
MIRT006906 hsa-miR-196a-5p Luciferase reporter assay, qRT-PCR, Western blot 22876840
MIRT016043 hsa-miR-374b-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10879542
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142952 5106 ENSG00000106004
Protein
UniProt ID P20719
Protein name Homeobox protein Hox-A5 (Homeobox protein Hox-1C)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5'-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 196 252 Homeodomain Domain
Sequence
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG
SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKN
SLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKK
DNKLKSMSMAAAGGAFRP
Sequence length 270
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Carcinoma of the head and neck Squamous cell carcinoma of the head and neck rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001
View all (7 more)
22227861
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26035298, 35370463
Adrenocortical Carcinoma Inhibit 34027794
Alzheimer Disease Associate 37038196, 40244264
Androgen Insensitivity Syndrome Associate 21311178
Aneurysm Ascending Aorta Associate 28935963
Arthritis Psoriatic Associate 31701765
Arthritis Rheumatoid Associate 36398888
Asthma Associate 40349045
Astrocytoma Associate 24650279
ATR X syndrome Associate 37812190