Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3200
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXA3
Synonyms (NCBI Gene) Gene synonyms aliases
HOX1, HOX1E
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003164 hsa-miR-210-3p immunoprecipitaion, Microarray, qRT-PCR 19826008
MIRT019529 hsa-miR-151a-5p Sequencing 20371350
MIRT022611 hsa-miR-124-3p Microarray 18668037
MIRT025796 hsa-miR-7-5p Sequencing 20371350
MIRT027069 hsa-miR-103a-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142954 5104 ENSG00000105997
Protein
UniProt ID O43365
Protein name Homeobox protein Hox-A3 (Homeobox protein Hox-1E)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 192 248 Homeodomain Domain
PF13293 DUF4074 377 441 Domain of unknown function (DUF4074) Family
Sequence
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGG
HPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPP
PPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCA
GDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQ
NRRMKYKK
DQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKP
PQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHI
QGSPVFVGGSYVEPMSNSGPALFGLTHLPHAASGAMDYGGAGPLGSGHHHGPGPGEPHPT
YTDLTGHHPSQGRIQEAPKLT
HL
Sequence length 443
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension N/A N/A GWAS
Hypospadias Hypospadias N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Stimulate 30066858
Alzheimer Disease Associate 30045751, 37827850
Brain Neoplasms Associate 36215227
Carcinogenesis Associate 39658479
Carcinoma Non Small Cell Lung Associate 30066858
Carcinoma Renal Cell Associate 30975094, 32444962
Carcinoma Squamous Cell Associate 30066858
Colorectal Neoplasms Associate 24204606, 30066858
Diabetes Mellitus Associate 31626638
Glioblastoma Associate 36215227, 39849652