Gene Gene information from NCBI Gene database.
Entrez ID 3195
Gene name T cell leukemia homeobox 1
Gene symbol TLX1
Synonyms (NCBI Gene)
HOX11TCL3
Chromosome 10
Chromosome location 10q24.31
Summary This gene encodes a nuclear transcription factor that belongs to the NK-linked or NK-like (NKL) subfamily of homeobox genes. The encoded protein is required for normal development of the spleen during embryogenesis. This protein is also involved in specif
miRNA miRNA information provided by mirtarbase database.
107
miRTarBase ID miRNA Experiments Reference
MIRT019615 hsa-miR-340-5p Sequencing 20371350
MIRT029889 hsa-miR-26b-5p Microarray 19088304
MIRT652563 hsa-miR-5193 HITS-CLIP 23824327
MIRT652562 hsa-miR-660-3p HITS-CLIP 23824327
MIRT652561 hsa-miR-1915-5p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
MYC Unknown 20618946
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186770 5056 ENSG00000107807
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31314
Protein name T-cell leukemia homeobox protein 1 (Homeobox protein Hox-11) (Proto-oncogene TCL-3) (T-cell leukemia/lymphoma protein 3)
Protein function Controls the genesis of the spleen. Binds to the DNA sequence 5'-GGCGGTAAGTGG-3'.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 202 258 Homeodomain Domain
Sequence
MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGG
GSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSS
GGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESN
RRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKM
TDAQVKTWFQNRRTKWRR
QTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHN
SSLFALQNLQPWSDDSTKITSVTSVASACE
Sequence length 330
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Transcriptional misregulation in cancer