Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	319101
Gene name Gene Name - the full gene name approved by the HGNC.	Keratin 73
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KRT73
Synonyms (NCBI Gene) Gene synonyms aliases	CK-73, IRT6IRS3, K6IRS3, K73, KRT6IRS3
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicle

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments
MIRT1101453	hsa-miR-1224-5p	CLIP-seq
MIRT1101454	hsa-miR-137	CLIP-seq
MIRT1101455	hsa-miR-143	CLIP-seq
MIRT1101456	hsa-miR-1827	CLIP-seq
MIRT1101457	hsa-miR-4428	CLIP-seq
MIRT1101458	hsa-miR-4499	CLIP-seq
MIRT1101459	hsa-miR-4649-3p	CLIP-seq
MIRT1101460	hsa-miR-4712-3p	CLIP-seq
MIRT1101461	hsa-miR-4751	CLIP-seq
MIRT1101462	hsa-miR-4770	CLIP-seq
MIRT1101463	hsa-miR-495	CLIP-seq
MIRT1101464	hsa-miR-548u	CLIP-seq
MIRT2027581	hsa-miR-3170	CLIP-seq
MIRT2027582	hsa-miR-4514	CLIP-seq
MIRT2027583	hsa-miR-4692	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0031424	Process	Keratinization	IBA
GO:0045095	Component	Keratin filament	IBA
GO:0045095	Component	Keratin filament	IEA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145

MIM	HGNC	e!Ensembl
608247	28928	ENSG00000186049

Protein

UniProt ID

Q86Y46

Protein name

Keratin, type II cytoskeletal 73 (Cytokeratin-73) (CK-73) (Keratin-73) (K73) (Type II inner root sheath-specific keratin-K6irs3) (Type-II keratin Kb36)

Protein function

Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (Probable).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16208	Keratin_2_head	62 → 128	Keratin type II head	Family
PF00038	Filament	131 → 444	Intermediate filament protein	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in hair follicles from scalp. In hair, it is specifically present in the inner root sheath (IRS) of the hair follicle. Present in the IRS cuticle, but not in Henle or Huxley layers of the IRS. In the IRS cuticle, it is

Sequence

MSRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSSRSLYSLGGARSISFN
VASGSGWAGGYGFGRGRASGFAGSMFGSVALGSVCPSLCPPGGIHQVTINKSLLAPLNVE
LDPEIQKVRAQEREQIKVLNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLE
PILEGYISNLRKQLETLSGDRVRLDSELRSVREVVEDYKKRYEEEINKRTTAENEFVVLK
KDVDAAYTSKVELQAKVDALDGEIKFFKCLYEGETAQIQSHISDTSIILSMDNNRNLDLD
SIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLKHTKNEISELTRLIQRL
RSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEELARMLREYQEL
LSVKLSLDIEIATYRKLLEGEECRMSGEYTNSVSISVINSSMAGMAGTGAGFGFSNAGTY
GYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR

Sequence length

540

Interactions

View interactions

	Reactome
			Keratinization Formation of the cornified envelope

KRT73 (keratin 73)