Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3191
Gene name Gene Name - the full gene name approved by the HGNC.
Heterogeneous nuclear ribonucleoprotein L
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HNRNPL
Synonyms (NCBI Gene) Gene synonyms aliases
HNRPL, P/OKcl.14, hnRNP-L
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are sta
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016285 hsa-miR-193b-3p Proteomics 21512034
MIRT025002 hsa-miR-183-5p Sequencing 20371350
MIRT051924 hsa-let-7b-5p CLASH 23622248
MIRT051122 hsa-miR-16-5p CLASH 23622248
MIRT051122 hsa-miR-16-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IEA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IMP 25623890
GO:0000785 Component Chromatin IDA 33174841
GO:0000976 Function Transcription cis-regulatory region binding IDA 11809897
GO:0003676 Function Nucleic acid binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603083 5045 ENSG00000104824
Protein
UniProt ID P14866
Protein name Heterogeneous nuclear ribonucleoprotein L (hnRNP L)
Protein function Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elements (PubMed:11809897, PubMed:22570490, PubMed:24164894, PubMed:25623890, PubMed:
PDB 3R27 , 3TO8 , 7EVR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 104 162 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF11835 RRM_8 184 270 RRM-like domain Domain
PF13893 RRM_5 356 480 Domain
Sequence
MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKR
LKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVE
ALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQI
YIAGHPAFVNYSTSQKIS
RPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDS
VQSAQRAKASLNGADIYSGCCTLKIEYAKP
TRLNVFKNDQDTWDYTNPNLSGQGDPGSNP
NKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYG
PQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPG
AAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSES

RNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSE
RSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS
Sequence length 589
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
Prostate cancer Prostate cancer HNRNPL Is Required for Prostate Cancer Cell Growth. 28611215 CBGDA
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 32915499
Amyotrophic Lateral Sclerosis Associate 36930682
Autoimmune Diseases Associate 21507955
Brain Diseases Associate 29484035
Carcinogenesis Associate 20972326, 28088793, 28520992, 31828152
Carcinoma Non Small Cell Lung Associate 20972326, 28296343
Carcinoma Pancreatic Ductal Associate 34779408
Cerebral Palsy Associate 29484035
Colorectal Neoplasms Associate 31320608
Endometrial Neoplasms Associate 32915499