Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	317671
Gene name Gene Name - the full gene name approved by the HGNC.	Rieske Fe-S domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RFESD
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q15

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT1301673	hsa-miR-24	CLIP-seq
MIRT1301674	hsa-miR-3133	CLIP-seq
MIRT1301675	hsa-miR-4284	CLIP-seq
MIRT1301676	hsa-miR-4420	CLIP-seq
MIRT1301677	hsa-miR-4427	CLIP-seq
MIRT1301678	hsa-miR-1297	CLIP-seq
MIRT1301679	hsa-miR-1305	CLIP-seq
MIRT1301680	hsa-miR-132	CLIP-seq
MIRT1301681	hsa-miR-140-5p	CLIP-seq
MIRT1301682	hsa-miR-212	CLIP-seq
MIRT1301683	hsa-miR-214	CLIP-seq
MIRT1301684	hsa-miR-26a	CLIP-seq
MIRT1301685	hsa-miR-26b	CLIP-seq
MIRT1301686	hsa-miR-3149	CLIP-seq
MIRT1301687	hsa-miR-3619-5p	CLIP-seq
MIRT1301688	hsa-miR-4291	CLIP-seq
MIRT1301689	hsa-miR-4465	CLIP-seq
MIRT1301690	hsa-miR-498	CLIP-seq
MIRT1301691	hsa-miR-548a-3p	CLIP-seq
MIRT1301692	hsa-miR-548e	CLIP-seq
MIRT1301693	hsa-miR-548f	CLIP-seq
MIRT1301694	hsa-miR-568	CLIP-seq
MIRT1301695	hsa-miR-651	CLIP-seq
MIRT1301696	hsa-miR-761	CLIP-seq
MIRT1301697	hsa-miR-922	CLIP-seq
MIRT1301698	hsa-miR-4728-3p	CLIP-seq
MIRT1301699	hsa-miR-7	CLIP-seq
MIRT2089523	hsa-miR-548c-3p	CLIP-seq
MIRT2610857	hsa-miR-1290	CLIP-seq
MIRT2610858	hsa-miR-337-3p	CLIP-seq
MIRT2610859	hsa-miR-3685	CLIP-seq
MIRT2610860	hsa-miR-384	CLIP-seq
MIRT2610857	hsa-miR-1290	CLIP-seq
MIRT2610858	hsa-miR-337-3p	CLIP-seq
MIRT2610859	hsa-miR-3685	CLIP-seq
MIRT2610860	hsa-miR-384	CLIP-seq

Show/Hide all(3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0046872	Function	Metal ion binding	IEA
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8TAC1

Protein name

Rieske domain-containing protein

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00355	Rieske	16 → 109	Rieske [2Fe-2S] domain	Domain

Sequence

MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIH
TVTVDNGNIYVTLSNEPFKCDSDFYATGDFKVIKSSS

Sequence length

157

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	25944848

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Unipolar Depression, Major Depressive Disorder		25944848	ClinVar

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	33159718
Carcinoma Hepatocellular	Associate	35681134
Hepatitis D	Associate	35681134

RFESD (Rieske Fe-S domain containing)