Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	317671
Gene name Gene Name - the full gene name approved by the HGNC.	Rieske Fe-S domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RFESD
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q15

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT1301673	hsa-miR-24	CLIP-seq
MIRT1301674	hsa-miR-3133	CLIP-seq
MIRT1301675	hsa-miR-4284	CLIP-seq
MIRT1301676	hsa-miR-4420	CLIP-seq
MIRT1301677	hsa-miR-4427	CLIP-seq
MIRT1301678	hsa-miR-1297	CLIP-seq
MIRT1301679	hsa-miR-1305	CLIP-seq
MIRT1301680	hsa-miR-132	CLIP-seq
MIRT1301681	hsa-miR-140-5p	CLIP-seq
MIRT1301682	hsa-miR-212	CLIP-seq
MIRT1301683	hsa-miR-214	CLIP-seq
MIRT1301684	hsa-miR-26a	CLIP-seq
MIRT1301685	hsa-miR-26b	CLIP-seq
MIRT1301686	hsa-miR-3149	CLIP-seq
MIRT1301687	hsa-miR-3619-5p	CLIP-seq
MIRT1301688	hsa-miR-4291	CLIP-seq
MIRT1301689	hsa-miR-4465	CLIP-seq
MIRT1301690	hsa-miR-498	CLIP-seq
MIRT1301691	hsa-miR-548a-3p	CLIP-seq
MIRT1301692	hsa-miR-548e	CLIP-seq
MIRT1301693	hsa-miR-548f	CLIP-seq
MIRT1301694	hsa-miR-568	CLIP-seq
MIRT1301695	hsa-miR-651	CLIP-seq
MIRT1301696	hsa-miR-761	CLIP-seq
MIRT1301697	hsa-miR-922	CLIP-seq
MIRT1301698	hsa-miR-4728-3p	CLIP-seq
MIRT1301699	hsa-miR-7	CLIP-seq
MIRT2089523	hsa-miR-548c-3p	CLIP-seq
MIRT2610857	hsa-miR-1290	CLIP-seq
MIRT2610858	hsa-miR-337-3p	CLIP-seq
MIRT2610859	hsa-miR-3685	CLIP-seq
MIRT2610860	hsa-miR-384	CLIP-seq
MIRT2610857	hsa-miR-1290	CLIP-seq
MIRT2610858	hsa-miR-337-3p	CLIP-seq
MIRT2610859	hsa-miR-3685	CLIP-seq
MIRT2610860	hsa-miR-384	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IBA
GO:0051537	Function	2 iron, 2 sulfur cluster binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8TAC1

Protein name

Rieske domain-containing protein

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00355	Rieske	16 → 109	Rieske [2Fe-2S] domain	Domain

Sequence

MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIH
TVTVDNGNIYVTLSNEPFKCDSDFYATGDFKVIKSSS

Sequence length

157

Interactions

View interactions

RFESD (Rieske Fe-S domain containing)