Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3171
Gene name	Forkhead box A3
Gene symbol	FOXA3
Synonyms (NCBI Gene)	FKHH3HNF3GTCF3G
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017722	hsa-miR-335-5p	Microarray	18185580
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT1996767	hsa-miR-1976	CLIP-seq
MIRT1996768	hsa-miR-3619-3p	CLIP-seq
MIRT1996769	hsa-miR-3690	CLIP-seq
MIRT1996770	hsa-miR-4254	CLIP-seq
MIRT1996771	hsa-miR-4279	CLIP-seq
MIRT1996772	hsa-miR-4776-5p	CLIP-seq
MIRT2230728	hsa-miR-101	CLIP-seq
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT2230729	hsa-miR-1910	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT2230730	hsa-miR-4519	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IMP	9369482, 12695546, 18239190
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	TAS	9369482
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12695546
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7739897, 9369482
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7739897
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12695546
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602295	5023	ENSG00000170608

P55318

Protein name

Hepatocyte nuclear factor 3-gamma (HNF-3-gamma) (HNF-3G) (Fork head-related protein FKH H3) (Forkhead box protein A3) (Transcription factor 3G) (TCF-3G)

Protein function

Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sit

PDB

1VTN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08430	Forkhead_N	16 → 116	Forkhead N-terminal region	Family
PF00250	Forkhead	116 → 202	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. {ECO:0000269|PubMed:8499623}.

Sequence

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY
SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR
SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST
TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

Sequence length

350

Interactions

View interactions

	KEGG
	Maturity onset diabetes of the young

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
FOXA3-related disorder	Benign; Likely benign	rs3810327, rs16980091, rs200743469, rs146135785, rs541734780, rs547423844, rs144459600	RCV003979773 RCV003982334 RCV003973978 RCV003924603 RCV003952039 RCV003969308 RCV003931949

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aortic Valve Calcification of	Associate	35625529
Asthma	Associate	35347136
Atherosclerosis	Inhibit	35625529
Cakut	Associate	34473308
Carcinoma Hepatocellular	Associate	35764883
Cholangiocarcinoma	Associate	32151057
Hepatoblastoma	Associate	33368532
Hypoxia	Associate	35764883
Inflammation	Associate	35347136
Insulin Resistance	Associate	35625529
Magnesium Deficiency	Associate	35625529
Metaplasia	Associate	32275839, 35347136
Mucus Inspissation of Respiratory Tract	Associate	35347136
Neoplasm Metastasis	Stimulate	32151057
Neoplasm Metastasis	Associate	35764883
Neoplasms	Inhibit	24798046

FOXA3 (forkhead box A3)