Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3171
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXA3
Synonyms (NCBI Gene) Gene synonyms aliases	FKHH3, HNF3G, TCF3G
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017722	hsa-miR-335-5p	Microarray	18185580
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT1996767	hsa-miR-1976	CLIP-seq
MIRT1996768	hsa-miR-3619-3p	CLIP-seq
MIRT1996769	hsa-miR-3690	CLIP-seq
MIRT1996770	hsa-miR-4254	CLIP-seq
MIRT1996771	hsa-miR-4279	CLIP-seq
MIRT1996772	hsa-miR-4776-5p	CLIP-seq
MIRT2230728	hsa-miR-101	CLIP-seq
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT2230729	hsa-miR-1910	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT2230730	hsa-miR-4519	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IMP	9369482, 12695546, 18239190
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	TAS	9369482
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12695546
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7739897, 9369482
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7739897
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12695546
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602295	5023	ENSG00000170608

Protein

UniProt ID

P55318

Protein name

Hepatocyte nuclear factor 3-gamma (HNF-3-gamma) (HNF-3G) (Fork head-related protein FKH H3) (Forkhead box protein A3) (Transcription factor 3G) (TCF-3G)

Protein function

Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sit

PDB

1VTN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08430	Forkhead_N	16 → 116	Forkhead N-terminal region	Family
PF00250	Forkhead	116 → 202	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. {ECO:0000269|PubMed:8499623}.

Sequence

MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY
SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR
SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST
TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

Sequence length

350

Interactions

View interactions

	KEGG
	Maturity onset diabetes of the young

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma (adult onset), Asthma, Nonatopic asthma	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aortic Valve Calcification of	Associate	35625529
Asthma	Associate	35347136
Atherosclerosis	Inhibit	35625529
Cakut	Associate	34473308
Carcinoma Hepatocellular	Associate	35764883
Cholangiocarcinoma	Associate	32151057
Hepatoblastoma	Associate	33368532
Hypoxia	Associate	35764883
Inflammation	Associate	35347136
Insulin Resistance	Associate	35625529
Magnesium Deficiency	Associate	35625529
Metaplasia	Associate	32275839, 35347136
Mucus Inspissation of Respiratory Tract	Associate	35347136
Neoplasm Metastasis	Stimulate	32151057
Neoplasm Metastasis	Associate	35764883
Neoplasms	Inhibit	24798046

FOXA3 (forkhead box A3)