FOXA3 (forkhead box A3)

Gene

• Entrez ID: 3171
• Gene name: Forkhead box A3
• Gene symbol: FOXA3
• Synonyms (NCBI Gene): FKHH3, HNF3G, TCF3G
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017722	hsa-miR-335-5p	Microarray	18185580
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT1996767	hsa-miR-1976	CLIP-seq
MIRT1996768	hsa-miR-3619-3p	CLIP-seq
MIRT1996769	hsa-miR-3690	CLIP-seq
MIRT1996770	hsa-miR-4254	CLIP-seq
MIRT1996771	hsa-miR-4279	CLIP-seq
MIRT1996772	hsa-miR-4776-5p	CLIP-seq
MIRT2230728	hsa-miR-101	CLIP-seq
MIRT1001480	hsa-miR-128	CLIP-seq
MIRT2230729	hsa-miR-1910	CLIP-seq
MIRT1001481	hsa-miR-27a	CLIP-seq
MIRT1001482	hsa-miR-27b	CLIP-seq
MIRT1001483	hsa-miR-4274	CLIP-seq
MIRT2230730	hsa-miR-4519	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq
MIRT2449842	hsa-miR-3613-3p	CLIP-seq
MIRT2449843	hsa-miR-3941	CLIP-seq
MIRT2449844	hsa-miR-466	CLIP-seq
MIRT2449845	hsa-miR-4672	CLIP-seq
MIRT2449846	hsa-miR-4694-5p	CLIP-seq
MIRT2449847	hsa-miR-4790-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IMP	9369482, 12695546, 18239190
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001678	Process	Cellular glucose homeostasis	TAS	9369482
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12695546
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9369482
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	TAS	7739897
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007275	Process	Multicellular organism development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008134	Function	Transcription factor binding	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA	21873635
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12695546
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 602295
• HGNC: 5023
• e!Ensembl: ENSG00000170608

Protein

• UniProt ID: P55318
• Protein name: Hepatocyte nuclear factor 3-gamma (HNF-3-gamma) (HNF-3G) (Fork head-related protein FKH H3) (Forkhead box protein A3) (Transcription factor 3G) (TCF-3G)
• Protein function: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sit
• PDB: 1VTN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08430	Forkhead_N	16 → 116	Forkhead N-terminal region	Family
  PF00250	Forkhead	116 → 202	Forkhead domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. {ECO:0000269|PubMed:8499623}.
• Sequence:

  MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
  PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY
  SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR
  SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST
  TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
  NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

• Sequence length: 350

Pathways

KEGG:

Maturity onset diabetes of the young

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	22919386

Unknown
Disease term	Disease name	Evidence	References	Source
Asthma	Asthma			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Aortic Valve Calcification of	Associate	35625529
Asthma	Associate	35347136
Atherosclerosis	Inhibit	35625529
Cakut	Associate	34473308
Carcinoma Hepatocellular	Associate	35764883
Cholangiocarcinoma	Associate	32151057
Hepatoblastoma	Associate	33368532
Hypoxia	Associate	35764883
Inflammation	Associate	35347136
Insulin Resistance	Associate	35625529
Magnesium Deficiency	Associate	35625529
Metaplasia	Associate	32275839, 35347136
Mucus Inspissation of Respiratory Tract	Associate	35347136
Neoplasm Metastasis	Stimulate	32151057
Neoplasm Metastasis	Associate	35764883
Neoplasms	Inhibit	24798046