FOXA2 (forkhead box A2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3170
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box A2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXA2
Synonyms (NCBI Gene) Gene synonyms aliases
HNF-3-beta, HNF3B, TCF3B
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family mem
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
miRTarBase ID miRNA Experiments Reference
MIRT017120 hsa-miR-335-5p Microarray 18185580
MIRT017120 hsa-miR-335-5p Luciferase reporter assay, qRT-PCR, Western blot 24449834
MIRT017120 hsa-miR-335-5p Luciferase reporter assay, qRT-PCR, Western blot 24449834
MIRT440616 hsa-miR-1185-2-3p HITS-CLIP 24374217
MIRT440617 hsa-miR-1185-1-3p HITS-CLIP 24374217
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
GLI2 Unknown 19360354
SMAD3 Unknown 21625455
USF1 Activation 22460558
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(43)
GO ID Ontology Definition Evidence Reference
GO:0000432 Process Positive regulation of transcription from RNA polymerase II promoter by glucose ISS
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IMP 15737987
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12642491
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600288 5022 ENSG00000125798
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y261
Protein name Hepatocyte nuclear factor 3-beta (HNF-3-beta) (HNF-3B) (Forkhead box protein A2) (Transcription factor 3B) (TCF-3B)
Protein function Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin
PDB 5X07 , 7YZE , 7YZF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08430 Forkhead_N 16 → 158 Forkhead N-terminal region Family
PF00250 Forkhead 158 → 244 Forkhead domain Domain
PF09354 HNF_C 373 → 446 HNF3 C-terminal domain Domain
Sequence 
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG
TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP
EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Sequence length 457
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Longevity regulating pathway - multiple species
Maturity onset diabetes of the young 		 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Hyperinsulinemic hypoglycemia Congenital Hyperinsulinism rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402
View all (71 more)		 29329447
Hyperinsulinism Hyperinsulinism rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209
View all (23 more)		 28973288
Pituitary hormone deficiency Combined pituitary hormone deficiencies, genetic forms rs104893754, rs104893756, rs104893757, rs104893759, rs104893760, rs104893761, rs104893762, rs587776798, rs104893758, rs104893763, rs104893764, rs104893765, rs587776799, rs104893766, rs370761964
View all (7 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Pituitary Hormone Deficiency combined pituitary hormone deficiencies, genetic form GenCC
Show/Hide Text Mining Associations (69)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 27586588, 30670912
Adenocarcinoma Mucinous Associate 33024306
Adenocarcinoma of Lung Associate 26658322, 30796052, 31503425
Barrett Esophagus Associate 27586588, 30670912
Biliary Atresia Associate 25765999
Breast Neoplasms Associate 31701999
Cakut Associate 34473308
Carcinogenesis Associate 26658322, 27538367, 29720137
Carcinoma Endometrioid Associate 28940304
Carcinoma Hepatocellular Associate 10799560, 1732730, 20967225, 25425543