Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3169
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXA1
Synonyms (NCBI Gene) Gene synonyms aliases
HNF3A, TCF3A
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT024644 hsa-miR-215-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
AR Unknown 12750453
CREB1 Unknown 22577344
FOS Unknown 22577344
TFAP2A Unknown 22577344
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 16087863, 16331276, 19127412
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602294 5021 ENSG00000129514
Protein
UniProt ID P55317
Protein name Hepatocyte nuclear factor 3-alpha (HNF-3-alpha) (HNF-3A) (Forkhead box protein A1) (Transcription factor 3A) (TCF-3A)
Protein function Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin
PDB 7VOX , 8VFY , 8VFZ , 8VG1 , 8VG2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08430 Forkhead_N 17 169 Forkhead N-terminal region Family
PF00250 Forkhead 169 255 Forkhead domain Domain
PF09354 HNF_C 397 461 HNF3 C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas. {ECO:0000269|PubMed:12234996, ECO:0000269|PubMed:15987773, ECO:0000269|PubMed:16331276}.
Sequence
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPH
AKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFE
NGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQ
GVYSRPVLNTS
Sequence length 472
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Estrogen-dependent gene expression
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast adenocarcinoma Breast adenocarcinoma rs28934874, rs112445441, rs121913279, rs121913286, rs104886003, rs121434592
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
23001124
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
23001124
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
23001124
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 35148669
Adenocarcinoma Associate 30720096, 35049068
Adenocarcinoma Mucinous Associate 34042091
Adenocarcinoma of Lung Associate 26658322, 35974000
Androgen Insensitivity Syndrome Associate 29880907
Asthma Associate 31430856
Bone Marrow Diseases Associate 30881995
Breast Carcinoma In Situ Associate 35477749
Breast Neoplasms Associate 16087863, 16980581, 19549328, 19946260, 20068169, 20132413, 20501593, 21151129, 21167036, 21701558, 21878914, 21882221, 22272226, 22313737, 22391567
View all (78 more)
Breast Neoplasms Stimulate 24887547, 38254989