Gene Gene information from NCBI Gene database.
Entrez ID 3169
Gene name Forkhead box A1
Gene symbol FOXA1
Synonyms (NCBI Gene)
HNF3ATCF3A
Chromosome 14
Chromosome location 14q21.1
Summary This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar fami
miRNA miRNA information provided by mirtarbase database.
580
miRTarBase ID miRNA Experiments Reference
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002078 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT024644 hsa-miR-215-5p Microarray 19074876
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
AR Unknown 12750453
CREB1 Unknown 22577344
FOS Unknown 22577344
TFAP2A Unknown 22577344
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
73
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16087863, 16331276, 19127412
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602294 5021 ENSG00000129514
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P55317
Protein name Hepatocyte nuclear factor 3-alpha (HNF-3-alpha) (HNF-3A) (Forkhead box protein A1) (Transcription factor 3A) (TCF-3A)
Protein function Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin
PDB 7VOX , 8VFY , 8VFZ , 8VG1 , 8VG2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08430 Forkhead_N 17 169 Forkhead N-terminal region Family
PF00250 Forkhead 169 255 Forkhead domain Domain
PF09354 HNF_C 397 461 HNF3 C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas. {ECO:0000269|PubMed:12234996, ECO:0000269|PubMed:15987773, ECO:0000269|PubMed:16331276}.
Sequence
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPH
AKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFE
NGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQ
GVYSRPVLNTS
Sequence length 472
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Estrogen-dependent gene expression