Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3164
Gene name	Nuclear receptor subfamily 4 group A member 1
Gene symbol	NR4A1
Synonyms (NCBI Gene)	GFRP1HMRN10NAK-1NGFIBNP10NUR77TR3
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018925	hsa-miR-335-5p	Microarray	18185580
MIRT023110	hsa-miR-124-3p	Microarray	18668037
MIRT026031	hsa-miR-196a-5p	Sequencing	20371350
MIRT032110	hsa-let-7d-5p	Sequencing	20371350
MIRT048853	hsa-miR-93-5p	CLASH	23622248
MIRT1192779	hsa-miR-15a	CLIP-seq
MIRT1192780	hsa-miR-15b	CLIP-seq
MIRT1192781	hsa-miR-16	CLIP-seq
MIRT1192782	hsa-miR-195	CLIP-seq
MIRT1192783	hsa-miR-214	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT1192785	hsa-miR-3152-3p	CLIP-seq
MIRT1192786	hsa-miR-3173-3p	CLIP-seq
MIRT1192787	hsa-miR-3177-3p	CLIP-seq
MIRT1192788	hsa-miR-3190	CLIP-seq
MIRT1192789	hsa-miR-3202	CLIP-seq
MIRT1192790	hsa-miR-3619-5p	CLIP-seq
MIRT1192791	hsa-miR-3652	CLIP-seq
MIRT1192792	hsa-miR-378g	CLIP-seq
MIRT1192793	hsa-miR-384	CLIP-seq
MIRT1192794	hsa-miR-3924	CLIP-seq
MIRT1192795	hsa-miR-3978	CLIP-seq
MIRT1192796	hsa-miR-424	CLIP-seq
MIRT1192797	hsa-miR-4430	CLIP-seq
MIRT1192798	hsa-miR-4459	CLIP-seq
MIRT1192799	hsa-miR-4476	CLIP-seq
MIRT1192800	hsa-miR-4491	CLIP-seq
MIRT1192801	hsa-miR-4530	CLIP-seq
MIRT1192802	hsa-miR-4533	CLIP-seq
MIRT1192803	hsa-miR-4645-3p	CLIP-seq
MIRT1192804	hsa-miR-4657	CLIP-seq
MIRT1192805	hsa-miR-4666-5p	CLIP-seq
MIRT1192806	hsa-miR-4695-5p	CLIP-seq
MIRT1192807	hsa-miR-4699-3p	CLIP-seq
MIRT1192808	hsa-miR-4722-5p	CLIP-seq
MIRT1192809	hsa-miR-4778-3p	CLIP-seq
MIRT1192810	hsa-miR-4779	CLIP-seq
MIRT1192811	hsa-miR-485-5p	CLIP-seq
MIRT1192812	hsa-miR-497	CLIP-seq
MIRT1192813	hsa-miR-511	CLIP-seq
MIRT1192814	hsa-miR-542-3p	CLIP-seq
MIRT1192815	hsa-miR-579	CLIP-seq
MIRT1192816	hsa-miR-616	CLIP-seq
MIRT1192817	hsa-miR-761	CLIP-seq
MIRT1192818	hsa-miR-875-3p	CLIP-seq
MIRT1192819	hsa-miR-124	CLIP-seq
MIRT1192779	hsa-miR-15a	CLIP-seq
MIRT1192780	hsa-miR-15b	CLIP-seq
MIRT1192781	hsa-miR-16	CLIP-seq
MIRT1192782	hsa-miR-195	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT1192788	hsa-miR-3190	CLIP-seq
MIRT1192820	hsa-miR-342-5p	CLIP-seq
MIRT1192792	hsa-miR-378g	CLIP-seq
MIRT1192793	hsa-miR-384	CLIP-seq
MIRT1192794	hsa-miR-3924	CLIP-seq
MIRT1192796	hsa-miR-424	CLIP-seq
MIRT1192821	hsa-miR-4484	CLIP-seq
MIRT1192800	hsa-miR-4491	CLIP-seq
MIRT1192822	hsa-miR-4509	CLIP-seq
MIRT1192803	hsa-miR-4645-3p	CLIP-seq
MIRT1192823	hsa-miR-4651	CLIP-seq
MIRT1192804	hsa-miR-4657	CLIP-seq
MIRT1192824	hsa-miR-4664-5p	CLIP-seq
MIRT1192805	hsa-miR-4666-5p	CLIP-seq
MIRT1192825	hsa-miR-4693-3p	CLIP-seq
MIRT1192807	hsa-miR-4699-3p	CLIP-seq
MIRT1192826	hsa-miR-4712-3p	CLIP-seq
MIRT1192827	hsa-miR-4717-3p	CLIP-seq
MIRT1192828	hsa-miR-4719	CLIP-seq
MIRT1192829	hsa-miR-4731-3p	CLIP-seq
MIRT1192830	hsa-miR-4742-3p	CLIP-seq
MIRT1192809	hsa-miR-4778-3p	CLIP-seq
MIRT1192831	hsa-miR-4801	CLIP-seq
MIRT1192812	hsa-miR-497	CLIP-seq
MIRT1192832	hsa-miR-506	CLIP-seq
MIRT1192813	hsa-miR-511	CLIP-seq
MIRT1192814	hsa-miR-542-3p	CLIP-seq
MIRT1192833	hsa-miR-548an	CLIP-seq
MIRT1192815	hsa-miR-579	CLIP-seq
MIRT1192834	hsa-miR-608	CLIP-seq
MIRT1192835	hsa-miR-615-5p	CLIP-seq
MIRT1192816	hsa-miR-616	CLIP-seq
MIRT1192836	hsa-miR-933	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT1192833	hsa-miR-548an	CLIP-seq
MIRT2055991	hsa-miR-637	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT1192787	hsa-miR-3177-3p	CLIP-seq
MIRT1192807	hsa-miR-4699-3p	CLIP-seq
MIRT1192788	hsa-miR-3190	CLIP-seq
MIRT1192789	hsa-miR-3202	CLIP-seq
MIRT1192791	hsa-miR-3652	CLIP-seq
MIRT1192793	hsa-miR-384	CLIP-seq
MIRT1192794	hsa-miR-3924	CLIP-seq
MIRT1192795	hsa-miR-3978	CLIP-seq
MIRT1192797	hsa-miR-4430	CLIP-seq
MIRT1192799	hsa-miR-4476	CLIP-seq
MIRT1192800	hsa-miR-4491	CLIP-seq
MIRT1192802	hsa-miR-4533	CLIP-seq
MIRT1192803	hsa-miR-4645-3p	CLIP-seq
MIRT1192804	hsa-miR-4657	CLIP-seq
MIRT1192805	hsa-miR-4666-5p	CLIP-seq
MIRT1192809	hsa-miR-4778-3p	CLIP-seq
MIRT1192813	hsa-miR-511	CLIP-seq
MIRT1192814	hsa-miR-542-3p	CLIP-seq
MIRT1192815	hsa-miR-579	CLIP-seq
MIRT1192816	hsa-miR-616	CLIP-seq
MIRT1192818	hsa-miR-875-3p	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT1192800	hsa-miR-4491	CLIP-seq
MIRT1192804	hsa-miR-4657	CLIP-seq
MIRT1192805	hsa-miR-4666-5p	CLIP-seq
MIRT1192784	hsa-miR-3120-3p	CLIP-seq
MIRT2582513	hsa-miR-1908	CLIP-seq
MIRT1192799	hsa-miR-4476	CLIP-seq
MIRT2582514	hsa-miR-663	CLIP-seq
MIRT2582515	hsa-miR-744	CLIP-seq
MIRT2582513	hsa-miR-1908	CLIP-seq
MIRT1192799	hsa-miR-4476	CLIP-seq
MIRT2582514	hsa-miR-663	CLIP-seq
MIRT2582515	hsa-miR-744	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HDAC7	Unknown	15623513
HIF1A	Activation	14729605
MEF2C	Repression	18079734
PML	Repression	12032831
SP1	Unknown	8961265

Show/Hide all (75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	8121493, 9315652, 18690216
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	ISS
GO:0001650	Component	Fibrillar center	IDA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	18059339
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	2626032
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	2626032
GO:0005515	Function	Protein binding	IPI	17139261, 18305892, 18835031, 18985028, 19095693, 20195357, 21988832, 22427340, 22761572, 24139859, 24316735, 25416956, 25822914, 25910212, 31515488
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8121493, 18690216
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	18690216
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	2626032
GO:0008270	Function	Zinc ion binding	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0032497	Process	Detection of lipopolysaccharide	IEA
GO:0032497	Process	Detection of lipopolysaccharide	ISS
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IBA
GO:0035767	Process	Endothelial cell chemotaxis	IMP	18059339
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	18059339
GO:0042116	Process	Macrophage activation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IMP	18059339
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22427340
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9315652, 18690216
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IBA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	ISS
GO:0160075	Process	Non-canonical inflammasome complex assembly	IEA
GO:0160075	Process	Non-canonical inflammasome complex assembly	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
139139	7980	ENSG00000123358

P22736

Protein name

Nuclear receptor subfamily 4immunitygroup A member 1 (Early response protein NAK1) (Nuclear hormone receptor NUR/77) (Nur77) (Orphan nuclear receptor HMR) (Orphan nuclear receptor TR3) (ST-59) (Testicular receptor 3)

Protein function

Orphan nuclear receptor. Binds the NGFI-B response element (NBRE) 5'-AAAGGTCA-3' (PubMed:18690216, PubMed:8121493, PubMed:9315652). Binds 9-cis-retinoic acid outside of its ligand-binding (NR LBD) domain (PubMed:18690216). Participates in energy

PDB

2QW4 , 3V3E , 3V3Q , 4JGV , 4KZI , 4KZJ , 4KZM , 4RE8 , 4REE , 4REF , 4RZE , 4RZF , 4RZG , 4WHF , 4WHG , 6KZ5 , 6LC1 , 8WUY , 8Y7L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	265 → 334	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	394 → 579	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Fetal muscle and adult liver, brain and thyroid.

Sequence

MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL
EGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Sequence length

598

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway PI3K-Akt signaling pathway Aldosterone synthesis and secretion Cortisol synthesis and secretion Cushing syndrome		AKT phosphorylates targets in the nucleus Nuclear Receptor transcription pathway Constitutive Signaling by AKT1 E17K in Cancer

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of esophagus	Benign	rs61734309	RCV005908635
Sarcoma	Benign	rs61734309	RCV005908636
Thyroid cancer, nonmedullary, 1	Benign	rs61734309	RCV005908637

Show/Hide Text Mining Associations (161)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Phase Reaction	Associate	27960568
Adenocarcinoma	Associate	35713363
Adenocarcinoma	Inhibit	36770929
Adenocarcinoma Follicular	Associate	18727708
Adenocarcinoma Mucinous	Associate	32781417
Agnosia	Stimulate	16945123, 40612672
Allan Herndon Dudley syndrome	Associate	35029184
Alzheimer Disease	Associate	18248459
Anemia Hemolytic	Associate	34880407
Angiomyolipoma	Associate	18374399
Arthritis Rheumatoid	Associate	32013628, 35508128
Astrocytoma	Inhibit	34863438
Atherosclerosis	Associate	12506026, 30134173, 36770940, 37881939
Atypical Mycobacteriosis Familial X Linked 2	Associate	32502940
Autism Spectrum Disorder	Associate	27430727, 34087420
Autistic Disorder	Associate	27430727, 34087420
Autoimmune Diseases	Associate	27246200
Brain Diseases	Associate	22898337
Brain Neoplasms	Associate	38547418
Breast Neoplasms	Associate	10970687, 11153143, 12223126, 1419611, 15193263, 16518065, 16685445, 16760268, 16799708, 16827799, 16869955, 16945123, 17142309, 17245003, 17352236 View all (576 more)
Breast Neoplasms	Stimulate	19239686, 19436038, 20642837, 21934103, 25216732, 35871138
Breast Neoplasms	Inhibit	23873108, 30280956
Breast Neoplasms Male	Associate	20863373, 24673740, 25684473, 25948676, 29396493
Calcinosis Cutis	Associate	32326897, 32566676, 33168657, 35220309, 36375389, 37166793
Carcinogenesis	Associate	34209871, 39972514
Carcinoma Adenosquamous	Associate	29145336
Carcinoma Basal Cell	Associate	25099655
Carcinoma Ductal	Associate	21747904, 22392042, 35051228, 38244435
Carcinoma Ductal	Stimulate	35029184
Carcinoma Ductal Breast	Associate	19420969, 22199306, 22424533, 25899789, 26512778, 34326378, 40305352
Carcinoma Endometrioid	Associate	23845225, 26045795, 31050196
Carcinoma Hepatocellular	Associate	19912993, 21241664, 21319187, 21659476, 30821058, 37357764
Carcinoma Intraductal Noninfiltrating	Associate	22887771, 30429518, 33945043, 38244435, 39209598
Carcinoma Lobular	Associate	20492711, 22961065, 34376532, 34817747, 37500962, 40645971
Carcinoma Non Small Cell Lung	Associate	30806032
Carcinoma Ovarian Epithelial	Associate	25520097, 29187928, 34071938
Carcinoma Papillary	Associate	22329832, 26813772
Carcinoma Renal Cell	Associate	20525362
Cardiovascular Diseases	Associate	35713363
Cartilage Diseases	Associate	35831280
Cataract	Associate	37131205
Cerebrovascular Disorders	Associate	37881939
Chronic Disease	Associate	30134173
Colorectal Neoplasms	Associate	10919358, 12492655, 24423919, 25099012, 33337350, 34975867
Conjunctivitis	Associate	31257177
Coronary Disease	Associate	31443660
COVID 19	Associate	36918693
Crohn Disease	Associate	34182489
Cystic Disease Of Lung	Associate	25070172
Death	Associate	12492655
Diabetes Mellitus	Associate	25854171
Diabetes Mellitus Type 2	Associate	30912283
Drug Related Side Effects and Adverse Reactions	Inhibit	26840408
Dry Eye Syndromes	Associate	31257177
Endocrine System Diseases	Associate	32502940, 36518248
Endometrial Neoplasms	Associate	18475299, 23932335, 26045795, 27420608, 31257177, 32210157
Endometriosis	Associate	34096590, 36232817
Fat Necrosis	Inhibit	29556076
Fatigue	Associate	31257177
Fatty Liver	Associate	29556076
Fetal Growth Retardation	Associate	29983832
Fibrosis	Associate	36482877
Gastrointestinal Hemorrhage	Associate	31257177
Glaucoma Angle Closure	Associate	37131205
Glioblastoma	Associate	30085274
Glioblastoma	Inhibit	34863438
Glioma	Associate	30085274
Glomerulonephritis	Associate	35484716
Glomerulonephritis IGA	Associate	28713898, 31392215, 38278877
Glomerulosclerosis Focal Segmental	Associate	35713363
Heart Failure	Associate	31257177
Hepatitis B	Associate	23025714
Hepatitis B	Stimulate	25908555
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30485330
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	33377972
HIV Infections	Inhibit	36499469
Hyperaldosteronism	Associate	21546879, 24531914
Hyperostosis corticalis deformans juvenilis	Inhibit	23620755
Hypertension Renal	Associate	24085434
Hypertensive Nephropathy	Associate	28713898
Hypoglycemia	Associate	25854171
Hypoxia	Stimulate	24423919
Hypoxia Brain	Associate	24423919
Inflammation	Associate	18248459, 22306153, 22789442, 27246200, 31356157, 34096590, 34209871, 35085325, 35713363, 35831280, 36359738, 36482877, 36499469
Inflammation	Inhibit	30134173, 32401747, 35484716
Inflammatory Bowel Diseases	Associate	27246200
Inflammatory Breast Neoplasms	Associate	29879283, 31854063, 32423453
Insulin Resistance	Associate	20525362
Keratitis	Associate	31257177
Kidney Diseases	Associate	35484716, 35713363
Learning Disabilities	Associate	27430727
Leiomyoma	Inhibit	23550059
Leiomyosarcoma	Associate	21161468
Leprosy Lepromatous	Inhibit	24214631
Leukemia	Associate	23247046
Leukemia Lymphocytic Chronic B Cell	Associate	12586635, 22374828
Leukemia Myeloid	Associate	36040481
Leukemia Myeloid Acute	Associate	23247046, 26938745
Leukemia Myeloid Acute	Inhibit	23247046, 37961948
Leukemia Prolymphocytic T Cell	Associate	23278106
Li Fraumeni Syndrome	Associate	22392042
Liver Failure	Associate	31257177
Lung Neoplasms	Associate	14612408, 25099012, 34816788, 9671482
Lung Neoplasms	Stimulate	25212775
Lymphatic Metastasis	Associate	23932335, 34057115
Lymphoma	Associate	12586635, 30266952
Lymphoma Large B Cell Diffuse	Associate	30266952
Medulloblastoma	Associate	26840408
Melanoma	Associate	1372901, 17297306
Memory Disorders	Associate	28353608
Migraine Disorders	Inhibit	26456840
Mitochondrial Diseases	Inhibit	29207128
Mood Disorders	Associate	16636682
Multiple Myeloma	Associate	37024444
Multiple Sclerosis	Associate	27246200
Myoma	Associate	39303426
Neoplasm Invasiveness	Associate	20124171
Neoplasm Metastasis	Associate	21163679, 22898337, 26811494, 28349782, 31050196, 35051228, 37169825
Neoplasm Metastasis	Inhibit	27832451
Neoplasm Recurrence Local	Associate	22621334, 34419555
Neoplasms	Associate	10550311, 12492655, 1558805, 15736474, 16033105, 16518065, 16826579, 17139261, 17352236, 17965112, 18501066, 18678838, 19156902, 19383883, 19436038 View all (74 more)
Neoplasms	Inhibit	10970687, 18727708, 19897535, 20642837, 21134077, 31050196
Neoplasms	Stimulate	20544688, 25142841, 25851628, 26840408
Neurodegenerative Diseases	Associate	23071566
Non alcoholic Fatty Liver Disease	Associate	36923221
Obesity	Associate	30912283
Osteoarthritis Hip	Associate	38200556
Osteosarcoma	Associate	39972514
Ovarian Neoplasms	Associate	19383883, 23845225, 25520097, 26937756, 27139372, 28264438, 28416763, 31495455, 32374631, 36430718, 37169775
Pancreatic Neoplasms	Associate	19584258, 24515801, 25275504, 28418095
Parkinson Disease	Associate	32401747
Parkinson Disease Secondary	Associate	32401747
Pelvic Organ Prolapse	Associate	32669951
Personality Disorders	Associate	22424533
Pituitary ACTH Hypersecretion	Associate	27025408
Prader Willi Syndrome	Associate	27430727
Prostatic Neoplasms	Associate	12947120, 23661456, 25151146, 37987209
Prostatitis	Associate	31243372
Pulmonary Disease Chronic Obstructive	Associate	39346628
Renal cell carcinoma 1	Associate	28664507
Renal Insufficiency	Associate	31257177
Renal Insufficiency Chronic	Associate	36923221
Rhabdomyosarcoma	Associate	31462501
Scleroderma Systemic	Associate	36482877
Spinal Diseases	Associate	26260940
Squamous Cell Carcinoma of Head and Neck	Associate	34667150
Stomach Neoplasms	Associate	26811494, 29207128, 36359738
Stroke	Associate	37490433
Supratentorial Neoplasms	Associate	30085274
Systemic Inflammatory Response Syndrome	Associate	30134173
T cell immunodeficiency primary	Associate	35224894
Takayasu Arteritis	Associate	35126357
Takotsubo Cardiomyopathy	Associate	28818208
Testicular Neoplasms	Associate	21437249
Thyroid Hormone Resistance Syndrome	Associate	27195705
Thyroid Neoplasms	Associate	29498706, 36407322
Tobacco Use Disorder	Associate	20659174
Triple Negative Breast Neoplasms	Associate	28029660, 28674186, 29222734, 34602069, 40681599
Urethral Neoplasms	Associate	31257177
Vascular Diseases	Associate	22049082, 22789442
Xeroderma Pigmentosum	Associate	28234911

NR4A1 (nuclear receptor subfamily 4 group A member 1)